Bioquímicos e reagentes

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>ELISA kit for the detection of Pregnenolone  in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA kit for detection of CD40 in the research laboratory</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>ELISA kit for the detection of MCP1 in the research laboratory</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>ELISA Kit for detection of Estradiol antibody in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>ELISA kit for the detection of Jo1 in the research laboratory</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>