Bioquímicos e reagentes

<p>Mouse monoclonal CHEK2 antibody</p>

<p>Prohibitin 2 antibody was raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK</p>

<p>The CYP3A4 antibody is a specific antibody used in Life Sciences research. It plays a crucial role in the metabolism of various drugs and toxins in the body. This cholinergic antibody targets the cytochrome P450 enzyme CYP3A4, which is primarily found in liver microsomes. By inhibiting the activity of CYP3A4, this antibody can help researchers understand the effects of drug interactions and develop more effective treatments.</p>

<p>C10orf119 antibody was raised in Rabbit using Human C10orf119 as the immunogen</p>

<p>Rabbit polyclonal PNMA2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NAT13 antibody, catalog no. 70R-1206</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD18 antibody, catalog no. 70R-2742</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRCC1 antibody, catalog no. 70R-9460</p>

<p>Ppp2r5e antibody was raised in rabbit using the N terminal of Ppp2r5e as the immunogen</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>PDCD4 antibody was raised in mouse using recombinant human PDCD4 (1-469aa) purified from E. coli as the immunogen.</p>

<p>The FANCA antibody is a polyclonal antibody that targets the purinergic receptor in mesenchymal stem cells and hematopoietic stem cells. This antibody is commonly used as a research reagent in the field of life sciences. It has shown potential as an anti-neoplastic agent, with studies suggesting its ability to inhibit the growth of cancer cells. The FANCA antibody interacts with G-protein coupled receptors, specifically targeting those expressed on mesenchymal stem cells. It can also be used in studies involving pluripotent stem cells and hematopoietic stem cells. Additionally, this antibody has been found to have an effect on cellular processes such as butyrate signaling. Its versatility and potential therapeutic applications make it a valuable tool for researchers in various fields.</p>

<p>FK506 antibody was raised in mouse using Tacrolimus conjugated to BSA as the immunogen.</p>

<p>The SAA1 Antibody is a highly effective antiviral inhibitor that is widely used in the field of Life Sciences. This antibody specifically targets human serum and has been shown to have a neutralizing effect on alpha-fetoprotein, a growth factor associated with various diseases. Additionally, the SAA1 Antibody exhibits strong binding affinity to antibodies such as fibrinogen, anti-mesothelin, and anti-cd33 antibody. This makes it an invaluable tool for researchers working with Monoclonal Antibodies. The SAA1 Antibody can be easily applied using an electrode for precise and accurate results. With its exceptional specificity and effectiveness, this antibody is a must-have for any laboratory or research facility.</p>

<p>Purified recombinant CHRAC1 protein (His tag)</p>

<p>Rabbit polyclonal GALR1 antibody</p>

<p>Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.</p>

<p>BLNK antibody was raised in Rabbit using Human BLNK as the immunogen</p>

<p>Recombinant Rat VEGFA protein</p>

<p>Rabbit polyclonal NSMCE2 antibody</p>

<p>CAPZA1 antibody was raised in Rabbit using Human CAPZA1 as the immunogen</p>

<p>Horse Red Blood Cells are widely used in various veterinary applications and life sciences research. These cells have unique characteristics that make them valuable in different experiments and studies.</p>

<p>Purified Rabbit polyclonal Mt38 antibody</p>

<p>RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGCGL2 antibody, catalog no. 70R-5282</p>

<p>Purified Polyclonal Beta glucosidase 2 antibody</p>

<p>MMP14 antibody was raised in Rabbit using Human MMP14 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LCAT antibody, catalog no. 70R-1860</p>

<p>IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG</p>

<p>Purified Rabbit polyclonal EPM2AIP1 antibody</p>

<p>Mouse monoclonal CD30 antibody (PE)</p>

<p>The p53 antibody is a monoclonal antibody used in Life Sciences research. It has a spherical morphology and is specifically designed for the immunohistochemical detection of the carboxy terminal of the human p53 protein. Monoclonal antibodies are highly specific and bind to a single epitope on the target protein, ensuring accurate and reliable results. This p53 antibody can be used to study the expression and localization of p53 in various tissues and cell types. It is also commonly used to investigate diseases such as cutaneous systemic sclerosis, where abnormal p53 expression has been observed. The p53 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to provide a comprehensive analysis of protein expression patterns. Its activation can trigger various cellular responses, including apoptosis, cell cycle arrest, and DNA repair mechanisms. By targeting the tetramerization domain of p53, this antibody can help researchers gain insights into its role in regulating critical cellular processes and its interactions with other proteins</p>

<p>BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EMP2 antibody, catalog no. 70R-1915</p>

<p>The Connexin 43 antibody is a highly specific and potent monoclonal antibody that targets the antigen Connexin 43. This antibody has been extensively tested and proven to effectively bind to Connexin 43 in various assays, making it an essential tool for researchers studying cellular communication and related processes.</p>

<p>The PSMA7 antibody is a highly viscous monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets the PSMA7 protein, which plays a crucial role in cellular processes such as interferon and interleukin-6 signaling. This monoclonal antibody is produced using advanced techniques and has been extensively tested to ensure its high quality and specificity.</p>

<p>DLK2 antibody was raised in Rabbit using Human DLK2 as the immunogen</p>

<p>FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS</p>

<p>Purified recombinant SRP19 protein (His tag)</p>

<p>The CD116 antibody is a highly specialized monoclonal antibody that targets the CD116 antigen. This antibody has been extensively researched in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal Ku70/80 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Its efficacy has been extensively tested using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>LRRC4C antibody was raised using the N terminal of LRRC4C corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE</p>

<p>The Synaptophysin antibody is a highly specialized antibody that targets the synaptophysin protein, which is involved in synaptic vesicle exocytosis. This antibody has been extensively studied and shown to have various applications in research and diagnostics.</p>

<p>Mouse monoclonal MOBKL2B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANP32B antibody, catalog no. 70R-3066</p>

<p>Slc25a31 antibody was raised in rabbit using the middle region of Slc25a31 as the immunogen</p>

<p>alpha 2 Macroglobulin antibody (HRP) was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDAH2 antibody, catalog no. 70R-5792</p>

<p>Cyclopentobarbital  5 Conjugate for use in immunoassays</p>

<p>SLC25A39 antibody was raised using the C terminal of SLC25A39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF</p>

<p>TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG</p>

<p>The Myc antibody is a monoclonal antibody that specifically targets c-Myc, a transcription factor involved in cell growth and proliferation. This antibody has been extensively studied for its ability to neutralize the activity of c-Myc and inhibit its binding to DNA. It has also been shown to disrupt the formation of actin filaments, which are essential for cellular structure and movement. Additionally, the Myc antibody exhibits potent anti-CD33 activity, making it a valuable tool for research and therapeutic applications. With its high specificity and affinity, this antibody is widely used in various fields, including cancer research, immunology, and cell biology. Whether you need to detect c-Myc expression or investigate its downstream signaling pathways, the Myc antibody is an indispensable tool for your research needs.</p>

<p>Pig Gamma Globulin is a highly versatile and valuable protein that plays a crucial role in various biological processes. It acts as a colony-stimulating factor, promoting the growth and development of specific cell types. Additionally, it interacts with transferrin, a protein involved in iron transport, to regulate plasma levels and ensure proper iron homeostasis.</p>

<p>SOHLH1 antibody was raised using the C terminal of SOHLH1 corresponding to a region with amino acids PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD</p>

<p>CDC20 antibody was raised in rabbit using the N terminal of CDC20 as the immunogen</p>

<p>The IFNAR1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the interferon alpha receptor 1 (IFNAR1). This glycoprotein plays a crucial role in the immune response by mediating the effects of interferons, which are important signaling molecules involved in antiviral and antitumor activities.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM78A antibody, catalog no. 70R-9322</p>

<p>Region of Relaxin 2 protein corresponding to amino acids (A-Chain): QLYSALANKC CHVGCTKRSL ARFC and (B-Chain): DSWMEEVIKL CGRELVRAQI AICGMSTWS.</p>

<p>Purified recombinant TPSAB1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1QB antibody, catalog no. 70R-5990</p>

<p>Rabbit polyclonal LAT antibody (Tyr191)</p>

<p>The RPS8 antibody is a highly specialized antibody that targets microvessel endothelial cells. It can be used in various fields, including industrial applications and life sciences research. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.</p>

<p>NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP</p>

<p>Rabbit Polyclonal ANXA13 antibody</p>

<p>DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogen</p>

<p>Purified Polyclonal CEP290 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC52 antibody, catalog no. 70R-3812</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR89 antibody, catalog no. 70R-3244</p>

<p>FAM3D antibody was raised in Rabbit using Human FAM3D as the immunogen</p>

<p>The RPA2 antibody is a monoclonal antibody with low density that specifically targets influenza hemagglutinin, a glycoprotein found on the surface of the influenza virus. This monoclonal antibody has been extensively studied and shown to have neutralizing properties against various strains of the influenza virus. In addition to its antiviral activity, the RPA2 antibody has also been found to play a role in iron homeostasis and cholesterol metabolism. Its interaction with transferrin and cholesterol oxidase suggests potential therapeutic applications in diseases related to iron metabolism and lipid disorders. With its unique glycosylation pattern, this antibody offers promising opportunities for research in the field of life sciences and may serve as a valuable tool in understanding various cellular processes.</p>

<p>Rat monoclonal CCR7 antibody (biotin)</p>

<p>SFN antibody was raised in rabbit using the N terminal of SFN as the immunogen</p>

<p>Rabbit polyclonal ACTN1 antibody</p>

<p>The AChE antibody is a highly specific antibody used in life sciences research. It can be either a polyclonal antibody or a monoclonal antibody, depending on the specific application. This antibody is designed to target and bind to acetylcholinesterase (AChE), an enzyme responsible for the breakdown of acetylcholine.</p>

<p>ZNF561 antibody was raised in rabbit using the C terminal of ZNF561 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP6 antibody, catalog no. 70R-2153</p>

<p>Insulin-Like Growth Factor Monoclonal Antibody (FITC)</p>

<p>CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST</p>

<p>Armenian Hamster monoclonal PD1 antibody (biotin)</p>

<p>Rabbit polyclonal TYW1B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP15 antibody, catalog no. 70R-4375</p>

<p>SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM</p>

<p>Rabbit polyclonal MLK1/2 antibody (Thr312/266)</p>

<p>ApoA-IV antibody was raised in Mouse using a purified recombinant fragment of APOA4 (aa21-396) expressed in E. coli as the immunogen.</p>

<p>KCNRG antibody was raised using the middle region of KCNRG corresponding to a region with amino acids DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD18 antibody, catalog no. 70R-2722</p>

<p>CD8a antibody was raised in mouse using porcine CD8a as the immunogen.</p>

<p>Purified Polyclonal COL8A1 antibody</p>

<p>The KNG1 antibody is a high-quality polyclonal antibody that specifically targets the glycoprotein known as KNG1. This antibody is derived from a mixture of different antibodies, making it highly effective in neutralizing the activity of KNG1. It has been extensively tested and proven to have a strong affinity for this surface glycoprotein.</p>

<p>Rabbit polyclonal Hemoglobin antibody (biotin)</p>

<p>RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX27 antibody, catalog no. 70R-1385</p>

<p>Goat anti-rabbit IgG (Fab'2) (Texas Red) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>Extracellular domain;22-125 amino acids: MQEEDLPRPS ISAEPGTVIP LGSHVTFVCR GPVGVQTFRL ERESRSTYND TEDVSQASPS ESEARFRIDS VSEGNAGPYR CIYYKPPKWS EQSDYLELLV KETSG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP6 antibody, catalog no. 70R-8007</p>

<p>Taf6l antibody was raised in rabbit using the middle region of Taf6l as the immunogen</p>

<p>The HPT antibody is a glycoprotein that belongs to the class of Monoclonal Antibodies. It exhibits cytotoxic properties and has been extensively studied in the field of Life Sciences. The HPT antibody specifically targets glutamate receptors and serine proteases, inhibiting their activity and preventing cell damage. In addition, it forms dimers that can be easily detected using colloidal gold labeling techniques. The HPT antibody has been shown to enhance the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. This antibody can also be used as an anti-prlr antibody, targeting the prolactin receptor and blocking its signaling pathway. Furthermore, the HPT antibody has been found to scavenge superoxide radicals, reducing oxidative stress in cells. Overall, this versatile antibody offers a wide range of applications in research and diagnostics within the field of Life Sciences.</p>

<p>PPM1 (PP2A Methyltransferase) Monoclonal Antibody</p>

<p>PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG</p>