Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.115 produtos)
- Por Alvo Biológico(99.074 produtos)
- Por uso/Efeitos Farmacológicos(6.785 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.693 produtos)
- Metabólitos secundários(14.219 produtos)
Foram encontrados 130577 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
DOR1 antibody
<p>DOR1 antibody was raised in rabbit using a synthetic peptide comprising residues 361-372 TPSDGPGGGAAA of the human DOR-1 protein as the immunogen.</p>Pureza:Min. 95%TIMP1 protein
<p>The TIMP1 protein is a versatile molecule with various characteristics and functions. It has been found to have interactions with interleukin-6, a basic protein that plays a crucial role in immune responses. Additionally, it has been shown to be involved in the formation of autoantibodies and possesses acetyltransferase activity.</p>Pureza:Min. 95%Ubiquitin antibody
<p>The Ubiquitin antibody is a cytotoxic monoclonal antibody that has neutralizing properties against ferritin, chemokines, and interferons. It is a glycoprotein that specifically targets ubiquitin, a protein involved in various cellular processes such as protein degradation and DNA repair. This antibody can be used in Life Sciences research to study the role of ubiquitin in different biological pathways. The Ubiquitin antibody has been tested for its efficacy in inhibiting hemolysis and has shown promising results. It does not contain any excipients or liver microsomes, making it safe for use in laboratory experiments.</p>Pureza:Min. 95%HIST1H1T antibody
<p>HIST1H1T antibody was raised using the middle region of HIST1H1T corresponding to a region with amino acids KLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRAT</p>UNC93B1 antibody
<p>UNC93B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK</p>AASDH Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AASDH antibody, catalog no. 70R-3281</p>Pureza:Min. 95%mCherry Fluorescent Protein
<p>mCherry Fluorescent Protein is a versatile tool widely used in the field of Life Sciences. It is a growth factor that can be utilized for various applications such as studying protein-protein interactions, monitoring gene expression, and visualizing cellular structures.</p>Pureza:Min. 95%TNK1 antibody
<p>TNK1 antibody is a reactive antibody that specifically targets the TNK1 protein. TNK1 is involved in various cellular processes, including the epidermal growth factor (EGF) signaling pathway. This antibody can be used in Life Sciences research to study the role of TNK1 in different biological systems. It has been shown to bind to TNK1 with high specificity and affinity. The TNK1 antibody can also be used as a diagnostic tool for detecting TNK1 levels in patient samples. Additionally, this antibody can be used in immunohistochemistry assays to visualize the localization of TNK1 within tissues. With its ability to recognize and bind to TNK1, this antibody offers researchers a valuable tool for understanding the function of this protein in various cellular processes.</p>Cortactin antibody
<p>Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG</p>Sideroflexin 4 antibody
<p>Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV</p>Pureza:Min. 95%SC5DL antibody
<p>SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV</p>Pureza:Min. 95%Goat anti Human IgM (Fab'2) (FITC)
<p>Goat anti-human IgM (Fab'2) (FITC) was raised in goat using human IgM Fc5m fragment as the immunogen.</p>Pureza:Min. 95%TNKS antibody
<p>The TNKS antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the activity of tankyrase enzymes. Tankyrases play a crucial role in various cellular processes, including the regulation of Wnt signaling, telomere maintenance, and DNA repair.</p>TRPM4 antibody
<p>The TRPM4 antibody is a high-quality monoclonal antibody that specifically targets the TRPM4 protein. This antibody is widely used in life sciences research and has been shown to have excellent specificity and sensitivity. It binds to the carbonyl group of the TRPM4 protein, inhibiting its activity and preventing downstream signaling pathways.</p>ABL1 antibody
<p>The ABL1 antibody is a mouse monoclonal antibody used in Life Sciences research. It specifically targets the antigen binding domain of the ABL1 protein, which is a human protein involved in various cellular processes. This monoclonal antibody can be used for cytometry analysis to detect and quantify the presence of ABL1 in cells.</p>Pureza:Min. 95%FAM156A antibody
<p>FAM156A antibody was raised using the middle region of FAM156A corresponding to a region with amino acids NRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQ</p>PHTF1 antibody
<p>PHTF1 antibody was raised in mouse using recombinant Putative Homeodomain Transcription Factor 1</p>cMet antibody
<p>The cMet antibody is a highly specialized antibody that targets the cMet protein, which plays a crucial role in various biological processes. This antibody can effectively bind to collagen, natriuretic peptides, elastase, and lectins, allowing for precise targeting of specific cells or tissues.</p>HSPA1A antibody
<p>The HSPA1A antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It specifically targets the HSPA1A protein, which is involved in various cellular processes such as stress response and protein folding. This antibody has been shown to neutralize the activity of HSPA1A, making it a valuable tool for research in understanding the role of this protein in different biological contexts.</p>PGCP antibody
<p>PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA</p>Pureza:Min. 95%ZNF605 antibody
<p>ZNF605 antibody was raised in rabbit using the N terminal of ZNF605 as the immunogen</p>Pureza:Min. 95%HGF antibody
<p>HGF antibody was raised in goat using S. frugiperda insect ovarian cell line Sf 21derived recombinant human HGF as the immunogen.</p>Pureza:Min. 95%Donkey anti Goat IgG (H + L) (rhodamine)
<p>Donkey anti-goat IgG (H + L) (rhodamine) was raised in donkey using goat IgG (H & L) as the immunogen.</p>Pureza:Min. 95%TK216
CAS:<p>TK216 is a monoclonal antibody that binds with high affinity and specificity to the leukocyte antigen CD19. TK216 is a humanized antibody that inhibits cell proliferation by inducing apoptosis, thereby inhibiting tumor growth. This drug targets CD19-expressing cells and has been shown to be effective in vitro as well as in vivo, where it has shown an inhibitory effect on xenograft tumor growth. TK216 has been evaluated in preclinical studies for its potential to treat hematologic malignancies such as leukemia and lymphoma.</p>Fórmula:C19H15Cl2NO3Pureza:Min. 95%Peso molecular:376.2 g/molACTN1 protein
<p>The ACTN1 protein is a vital component in the field of Life Sciences. It is a binding protein that can be targeted by monoclonal antibodies, making it a key player in various research and diagnostic applications. These monoclonal antibodies are highly specific and can be used to detect and quantify the presence of ACTN1 protein in biological samples.</p>Pureza:Min. 95%RALGPS2 antibody
<p>RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI</p>MRGPRX3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRGPRX3 antibody, catalog no. 70R-9932</p>Pureza:Min. 95%C6ORF146 antibody
<p>C6ORF146 antibody was raised using the middle region of C6Orf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP</p>Keratin K20 antibody
<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>
