Bioquímicos e reagentes

<p>Mycoplasma Pneumoniae IgG Positive, EBV VCA &amp; EBNA IgG Negative Serum for diagnostic applications</p>

<p>Please enquire for more information about RF IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mycoplasma Hominis IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide CKIHAREIFDSRGNPTVEC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Zika Virus IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mumps Virus IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Sodium DL-3-hydroxybutyrate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide Biot-PPDAATAAPLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about HSV-1/2 IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cytosolic Liver Antigen, Type 1 (Lc-1) Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CDK16 peptide substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about IgA Myeloma Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-EQLTPLI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about H. Pylori lgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>KZR-616 is a Chinese medicinal compound that acts as an inhibitor of tumor growth. It has shown promising results in human trials as an anticancer agent, particularly in the treatment of urinary tract cancers. KZR-616 works by targeting specific proteins that are involved in the cell cycle and promoting apoptosis (programmed cell death) in cancer cells. It is an analog of other kinase inhibitors, which have been successful in treating certain types of cancer. KZR-616 has the potential to be a powerful tool in the fight against cancer and is currently being studied further for its effectiveness and safety.</p>

<p>IgG Myeloma Human Plasma, Defibrinated for diagnostic applications</p>

<p>Please enquire for more information about Beta-2 Glycoprotein I Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HBsAg Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Coronavirus NL63 IgG Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ro-52 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-EEYNESIAFFYNRSG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EEYNESIAFFYNRSG-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EEYNESIAFFYNRSG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EEYNESIAFFYNRSG-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about EBV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH</p>

<p>Glucocorticoid receptor agonist; anti-inflammatory</p>

<p>Please enquire for more information about Mycoplasma Pneumoniae IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Influenza B Virus IgG Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vestipitant Mesylate is a drug used to treat Parkinson's disease and other neurological disorders. It is a prodrug that is converted to rotigotine in vivo. Vestipitant Mesylate has been shown to have a therapeutic effect on depression and symptoms of Parkinson's disease, such as tremors, stiffness, and slowness of movement. Vestipitant Mesylate can be administered orally or by injection. The active form, rotigotine, binds to the dopamine transporter protein in the brain and prevents the reuptake of dopamine. This leads to an increase in dopamine levels and alleviates Parkinsonian symptoms. Rotigotine also binds to cholinergic receptors in the brain, which may account for its antidepressant effects.</p>

<p>Galectin 3 protein is a recombinant protein that plays a crucial role in various life sciences applications. It interacts with a wide range of molecules, including interferon, collagen, and DNA aptamers. This protein is commonly used in research and diagnostic settings to study its neutralizing effects and to develop monoclonal antibodies for therapeutic purposes. Galectin 3 protein has also been found to be associated with the growth factor signaling pathway and the production of autoantibodies in human serum. Its glycoprotein nature makes it an essential component in understanding cellular processes and molecular interactions. Researchers rely on this versatile protein for its ability to bind to specific targets and facilitate accurate analysis in their experiments.</p>

<p>PF 00835231 is an investigational viral polymerase inhibitor, which is derived from the structural optimization of existing antiviral compounds. This small molecule manifests its mechanism of action by directly inhibiting the activity of the viral RNA-dependent RNA polymerase, a crucial enzyme in the replication machinery of coronaviruses. By binding to the active site of the polymerase, PF 00835231 effectively obstructs the replication process of viral RNA, thereby limiting viral proliferation within the host.</p>

<p>Please enquire for more information about CMV IgG (High Titer) Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Parvovirus B19 IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about dsDNA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Disperse Orange BRO-B including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-VLPLATFV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLPLATFV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLPLATFV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLPLATFV-OH at the technical inquiry form on this page</p>

<p>Streptococcus Group A Rabbit Polyclonal Antibody, Affinity Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Streptococcus Group A Rabbit Polyclonal Antibody, Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-FNAVLTNPQGDYDTSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Thioglycosyl Naphthalimide is a highly potent human O-GlcNAcase (hOGA) inhibitor with good selectivity against human β-N-acetylhexosaminidase B (HsHexB).</p>

<p>Cyclin-dependent kinase 12 modulator</p>

<p>H-Val-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is used as a building block for the synthesis of peptides. H-Val-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in dichloromethane and ether.</p>

<p>H-FIAEQILATL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FIAEQILATL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FIAEQILATL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FIAEQILATL-OH at the technical inquiry form on this page</p>

<p>Peptide H-ENATVAHLVGALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Potent Bcl-2/Bcl-xL inhibitor</p>

<p>Rotavirus antibody was raised in goat using nebraska calf diarrhea virus as the immunogen.</p>

<p>Selective partial GABAA receptor antagonist of subtypes  α1, α2, α3, α5 subunits. Non-sedative anxiolytic effects demonstrated in vivo, without compromising motor activity. Anti-nociceptive and anti-inflammatory activities also demonstrated in vivo.</p>

<p>Please enquire for more information about Cy7 DiSE(diSO3) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-IVAVTGAEAQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IVAVTGAEAQK-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IVAVTGAEAQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IVAVTGAEAQK-OH at the technical inquiry form on this page</p>

<p>Anti-diabetic and anti-obesity drug.  We also have the heavy labelled material, CRB1301886.<br>Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.</p>

<p>H-ESNGQPEGAT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ESNGQPEGAT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ESNGQPEGAT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ESNGQPEGAT-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascitic fluid as the immunogen.</p>