
Ácidos carboxílicos
Os ácidos carboxílicos são moléculas orgânicas caracterizadas por possuírem um grupo funcional carboxila (-COOH). Esses ácidos são fundamentais em várias reações químicas, incluindo esterificação, amidação e descarboxilação. Os ácidos carboxílicos são amplamente utilizados na produção de produtos farmacêuticos, polímeros e agroquímicos. Nesta seção, você pode encontrar uma grande variedade de ácidos carboxílicos prontos para uso. Na CymitQuimica, oferecemos uma ampla gama de ácidos carboxílicos de alta qualidade para apoiar suas aplicações de pesquisa e industriais.
Foram encontrados 12453 produtos de "Ácidos carboxílicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Methyl-N,N-diethyldithiocarbamate
CAS:<p>Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.</p>Fórmula:C6H13NS2Pureza:Min. 95%Cor e Forma:Colorless PowderPeso molecular:163.31 g/molAmyloid β-Protein (1-40) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>Fórmula:C194H295N53O58SPureza:Min. 95%Peso molecular:4,329.81 g/molMercuric acetate
CAS:Produto Controlado<p>Mercuric acetate is a salt of mercuric and acetic acid. It is used as an antiseptic, disinfectant, and preservative in the food industry. Mercuric acetate has been shown to have anti-inflammatory properties and is used for the treatment of inflammatory bowel disease. The ester linkage between the two molecules allows it to be hydrolysed into its components by enzymes such as esterases or glucuronidases, which may be one of the reasons for its therapeutic effects. Mercuric acetate also reacts with biological molecules, including proteins, nucleic acids, and carbohydrates. This reaction mechanism may contribute to its other biological properties such as lowering blood sugar levels and inhibiting glycolysis in cells that depend on sodium-dependent glucose transport mechanisms.</p>Fórmula:C4H6HgO4Pureza:Min. 95%Peso molecular:318.68 g/molpTH (2-34) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-34) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C178H286N54O49S2Pureza:Min. 95%Peso molecular:4,030.64 g/molNeuropeptide W-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C165H249N49O37SPureza:Min. 95%Peso molecular:3,543.12 g/mol(His(3-Me)2)-TRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H24N6O4Pureza:Min. 95%Peso molecular:376.41 g/molDSP
CAS:<p>DSP is a widely used disulfide crosslinker in ADC synthesis. It forms reversible conjugates via intracellular reduction, enabling payload release.</p>Fórmula:C14H16N2O8S2Pureza:Min. 95%Cor e Forma:SolidPeso molecular:404.42 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C82H135N21O32Pureza:Min. 95%Peso molecular:1,927.07 g/mol(D-Trp6)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H82N18O13·xC2H4O2Pureza:Min. 95%Peso molecular:1,311.45 g/mol(Gly14)-Humanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C118H202N34O31S2Pureza:Min. 95%Peso molecular:2,657.21 g/molBAM-22P (8-22) trifluoroacetate salt
CAS:<p>BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.</p>Fórmula:C91H127N25O23SPureza:Min. 95%Peso molecular:1,971.2 g/mol2-Amino-5-(trifluoromethoxy)benzoic acid
CAS:<p>Please enquire for more information about 2-Amino-5-(trifluoromethoxy)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H6F3NO3Pureza:Min. 95%Peso molecular:221.13 g/molAngiotensin A trifluoroacetate salt
CAS:<p>Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH is a drug that has been shown to be effective in treating chronic kidney disease and heart failure. It is a synthetic peptide that mimics the activity of angiotensin II, an important regulator of blood pressure. Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH binds to the angiotensin receptor, which causes vasoconstriction and increases the release of soluble guanylate cyclase. This drug also inhibits the production of matrix metalloproteinases, which break down collagen and other extracellular proteins.</p>Fórmula:C49H71N13O10Pureza:Min. 95%Peso molecular:1,002.17 g/molC-Type Natriuretic Peptide (1-53) (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Fórmula:C251H417N81O71S3Pureza:Min. 95%Peso molecular:5,801.7 g/molBradykinin (1-5) trifluoroacetate salt
CAS:<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>Fórmula:C27H40N8O6Pureza:Min. 95%Peso molecular:572.66 g/molMet(O)14-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about Met(O)14-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H282N50O61SPureza:Min. 95%Peso molecular:4,202.57 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H77N17O13·C2HF3O2Pureza:Min. 95%Peso molecular:1,310.34 g/molH-Lys-Gly-Asp-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H27N5O8Pureza:Min. 95%Peso molecular:405.4 g/molTRAP-6 amide trifluoroacetate salt
CAS:<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>Fórmula:C34H57N11O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:747.89 g/molmeso-Tartaric acid monohydrate
CAS:<p>Meso-tartaric acid monohydrate is a white crystalline substance that is soluble in water and has a strong acidic taste. It is an organic acid, which can be found in many fruits and vegetables. Meso-tartaric acid monohydrate is used as the sodium salt or potassium salt, which may lead to drug interactions with other drugs that are excreted through the kidneys. The product also inhibits the enzyme DPP-IV, which is involved in the degradation of glucagon and insulin. In addition, meso-tartaric acid monohydrate can cause an increase in surfactant sodium dodecyl sulfate (SDS) activity when it interacts with trifluoroacetic acid (TFA). Meso-tartaric acid monohydrate also prevents the growth of coli k-12 by inhibiting protein synthesis. This product has been shown to inhibit dpp-iv inhibitors from forming hydrogen bonds with malonic acid and polymorphon</p>Fórmula:C4H6O6·H2OPureza:Min. 95%Cor e Forma:White PowderPeso molecular:168.1 g/molL-Glutamic acid α-amide
CAS:<p>L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.</p>Fórmula:C5H10N2O3Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:146.14 g/molAmyloid b-Protein (6-20) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C86H119N23O23Pureza:Min. 95%Peso molecular:1,843.01 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H41N5O6Pureza:Min. 95%Peso molecular:459.58 g/molBiphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Fórmula:C46H56N10O10Pureza:Min. 95%Peso molecular:909 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Fórmula:C161H269N49O42Pureza:Min. 95%Peso molecular:3,563.16 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C199H314N62O60S5Pureza:Min. 95%Peso molecular:4,695.33 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Fórmula:C44H59N13O10SPureza:Min. 95%Peso molecular:962.09 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C173H265N53O44Pureza:Min. 95%Peso molecular:3,791.29 g/molDiphenolic acid
CAS:<p>Diphenolic acid is a reactive compound that is used as a solid catalyst. It has a hydroxyl group and a fatty acid, which makes it soluble in organic solvents. The methyl ethyl ester of diphenolic acid can be obtained from the reaction of diphenolic acid with methanol, ethanol or ethylene glycol. Diphenolic acid can also be obtained by reacting dibenzalacetone with an alcohol.<br>Diphenolic acid has been used to synthesize monoclonal antibodies and linear calibration curves for electrochemical impedance spectroscopy. The hydroxyl group on diphenolic acid allows it to undergo reactions that are not possible for other compounds such as phenols, leading to its use in surface methodology and flow systems.</p>Fórmula:C17H18O4Cor e Forma:White PowderPeso molecular:286.32 g/molLHRH (4-10) acetate salt
CAS:<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C33H53N11O9Pureza:Min. 95%Peso molecular:747.84 g/molH-Met-Arg-OH acetate salt
CAS:<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>Fórmula:C11H23N5O3SPureza:Min. 95%Peso molecular:305.4 g/molPep-1-cysteamide trifluoroacetate salt
CAS:<p>Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C140H202N36O33SPureza:Min. 95%Peso molecular:2,949.39 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Fórmula:C129H230N36O29SPureza:Min. 95%Peso molecular:2,781.5 g/molVIP (3-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C138H226N40O39SPureza:Min. 95%Peso molecular:3,101.58 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Fórmula:C50H73N13O11Pureza:Min. 95%Peso molecular:1,032.2 g/molGliadorphin-7 trifluoroacetate salt
CAS:<p>Gliadorphin is a peptide that occurs in cow's milk. It has been shown to be effective against bacterial translocation, which is the passage of bacteria from the gut into other parts of the body. Gliadorphin also has a safety profile, with no observed adverse effects in animal studies and dietary trials. The biological samples used for this study were casein and urine samples. The antibodies used were polyclonal antibodies and Gliadorphin was tested for its ability to bind to bacterial proteins in vivo. Hydration may be necessary for optimal absorption of gliadorphin, as dehydration can affect immune reaction. Gliadorphin does not have any known side effects or drug interactions, but it should not be used by people with an allergy to casein or those who are allergic to mammalian serine proteases (such as trypsin).</p>Fórmula:C43H57N9O11Pureza:Min. 95%Peso molecular:875.97 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C90H113N21O25Pureza:Min. 95%Peso molecular:1,888.99 g/mol(D-His2,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H82N18O13Pureza:Min. 95%Peso molecular:1,311.45 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C66H82N16O17SPureza:Min. 95%Peso molecular:1,403.52 g/molMet-Enkephalin acetate salt
CAS:<p>Please enquire for more information about Met-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C27H35N5O7S·xC2H4O2Pureza:Min. 95%Peso molecular:573.66 g/molOxyntomodulin (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C192H295N61O60SPureza:Min. 95%Peso molecular:4,449.84 g/molMca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C61H82N16O18Pureza:Min. 95%Peso molecular:1,327.4 g/mol(D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C158H265N49O43Pureza:Min. 95%Peso molecular:3,539.1 g/molEndothelin-2 (human, canine) acetate
CAS:<p>Acetate salt</p>Fórmula:C115H160N26O32S4Pureza:Min. 95%Peso molecular:2,546.92 g/molH-Met-Cys-Glu-Lys-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C19H35N5O7S2Pureza:Min. 95%Peso molecular:509.64 g/molFITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C131H191N37O25S2Pureza:Min. 95%Peso molecular:2,748.28 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C50H63N15O13Pureza:Min. 95%Peso molecular:1,082.13 g/molcis-4-Aminocyclohexanecarboxylic acid methyl ester hcl
CAS:<p>cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl is a chemical compound that is used in research and industry. It is an efficient isomer of 4-aminocyclohexanecarboxylic acid methyl ester hydrochloride. cis-4-Aminocyclohexanecarboxylic acid methyl ester hcl has been used as a model for the study of glimepiride, an insulin secretagogue, and has been shown to be active against Toxoplasma gondii.</p>Fórmula:C8H15NO2·HClPureza:Min. 95%Cor e Forma:SolidPeso molecular:193.67 g/molGLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C165H252N44O48S•(C2HF3O2)xPureza:Min. 95%Peso molecular:3,652.1 g/molEndothelin-2 (human, canine) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Fórmula:C115H160N26O32S4Pureza:Min. 95%Peso molecular:2,546.92 g/moltert-Butyl allylcarbamate
CAS:<p>Tert-Butyl allylcarbamate is a fluorinated, reactive compound that has been used in the synthesis of amines and phosphazenes. Tert-Butyl allylcarbamate is an intermediate for the synthesis of isophthalaldehyde, which can be used to produce polymers and other organic compounds. The reaction rate of tert-butyl allylcarbamate is inhibited by phosphazene, which also inhibits polymerization. Tert-Butyl allylcarbamate has been shown to inhibit transfer reactions involving functional groups such as allylamine, silicon, and fluoroalkyl.</p>Fórmula:C8H15NO2Pureza:Min. 95%Peso molecular:157.21 g/molSecretin (porcine) acetate salt
CAS:Produto Controlado<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>Fórmula:C130H220N44O41Pureza:Min. 95%Peso molecular:3,055.41 g/mol2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester
CAS:<p>2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester is a sunscreen agent that has been shown to be effective against the formation of skin cancer. This compound is a white powder that can be used as a cream or lotion and is typically applied to the skin before going out in the sun. 2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester absorbs ultraviolet radiation, preventing it from penetrating the skin and causing damage. The compound also acts as an antioxidant, protecting cells from oxidative stress.</p>Fórmula:C24H31NO4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:397.51 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C58H114N32O13SPureza:Min. 95%Peso molecular:1,499.8 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H65N13O11Pureza:Min. 95%Peso molecular:940.06 g/mol4-Amino-5-methoxy-2-methylbenzenesulfonic acid
CAS:<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>Fórmula:C8H11NO4SPureza:Min. 95%Cor e Forma:PowderPeso molecular:217.24 g/mol(Arg8)-Conopressin G trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H71N17O10S2Pureza:Min. 95%Peso molecular:1,062.28 g/mol(D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H95N19O13Pureza:Min. 95%Peso molecular:1,338.56 g/molDL-4-Hydroxymandelic acid
CAS:<p>DL-4-Hydroxymandelic acid is a phenolic acid that belongs to the family of organic acids. It is synthesized from 4-hydroxyphenylpyruvate and p-hydroxybenzoic acid by an enzyme called hydroxylase in the liver. The frequency shift in DL-4-Hydroxymandelic acid is caused by the hydrogen bonding between its hydroxyl group and pyran ring. This reaction occurs spontaneously, with no need for a catalyst or a change in pH. The reaction mechanism starts with the addition of water to the molecule, which results in an intermediate that breaks down into two molecules of formaldehyde and one molecule of formate. The reaction solution was found to be acidic because it contained H+ ions (H+).</p>Fórmula:C8H8O4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:168.15 g/molTri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate
CAS:<p>Tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate is a molecule that has been used in the diagnosis of cervical cancer. This drug binds to the metal chelator and is then attached to a water molecule by the functional group. This process makes the compound more stable and prevents it from reacting with other molecules. The cyclic peptide is then attached to the tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate molecule which can be detected by an MRI scan.</p>Fórmula:C26H50N4O6Pureza:Min. 95%Peso molecular:514.7 g/molChlorotoxin trifluoroacetate salt
CAS:<p>Chlorotoxin trifluoroacetate salt is a chlorotoxin derivative that has been modified to be more soluble in aqueous solutions. It is used to identify skin cancer and other forms of cancer, as well as for the study of cellular function and structure. The molecule can be injected into tissue or cells, where it binds to nuclei and causes cell death. Chlorotoxin trifluoroacetate salt has minimal toxicity in humans and can be used on histological specimens with little disruption to the tissue. This reagent may also be used to target intracellular targets such as glioma cells.</p>Fórmula:C158H249N53O47S11Pureza:Min. 95%Peso molecular:3,995.72 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS:<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>Fórmula:C17H18O3Pureza:Min. 95%Peso molecular:270.32 g/molLIP2 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H288N58O58Pureza:Min. 95%Peso molecular:4,240.61 g/mol2,3,4,5-Tetrafluorobenzoic acid
CAS:<p>Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.</p>Fórmula:C7H2F4O2Peso molecular:194.08 g/mol6-Bromohexanoic acid methyl ester
CAS:<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>Fórmula:C7H13BrO2Pureza:Min. 95%Cor e Forma:Clear LiquidPeso molecular:209.08 g/molBiotinyl-Obestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C126H190N34O35SPureza:Min. 95%Peso molecular:2,773.13 g/moltert-Butyl cis-4-hydroxycyclohexylcarbamate
CAS:<p>Tert-butyl cis-4-hydroxycyclohexylcarbamate is a pharmacological agent that has been shown to have anticonvulsant activity. It is a phenytoin amide that has neurotoxic effects and can cause convulsions. Tert-butyl cis-4-hydroxycyclohexylcarbamate binds to the sulfonamide site on the enzyme GABA transaminase, which converts GABA into succinic semialdehyde, thereby inhibiting the synthesis of GABA. This drug also inhibits the production of acetaldehyde from ethanol by preventing oxidation of NADH and NADPH. The tert-butyl cis-4-hydroxycyclohexylcarbamate was found to have an anticonvulsant effect in animals when given intravenously and orally. It also showed a protective effect against electroshock seizures in rats, suggesting an anticonvulsant activity.</p>Fórmula:C11H21NO3Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:215.29 g/molCART (55-76) (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (55-76) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C107H166N26O33S3Pureza:Min. 95%Peso molecular:2,440.82 g/molAc-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C33H51N9O8•C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:815.83 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H76N18O9S2Pureza:Min. 95%Peso molecular:1,209.45 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS:<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Fórmula:C86H104Cl2N18O13Pureza:Min. 95%Peso molecular:1,668.76 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C181H278N54O55Pureza:Min. 95%Peso molecular:4,090.47 g/molH-Gly-Tyr-NH2 acetate salt
CAS:Produto Controlado<p>Please enquire for more information about H-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H19N3O5Pureza:Min. 95%Peso molecular:297.31 g/molLQEQ-19 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about LQEQ-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C106H165N29O34Pureza:Min. 95%Peso molecular:2,389.62 g/mol(Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C137H212N40O30Pureza:Min. 95%Peso molecular:2,899.4 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS:<p>Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C9H11BO4Pureza:Min. 95%Peso molecular:193.99 g/molPyr-Pro-Val-pNA trifluoroacetate salt
CAS:<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>Fórmula:C21H27N5O6Pureza:Min. 95%Peso molecular:445.47 g/molSarafotoxin C trifluoroacetate salt
CAS:<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>Fórmula:C103H147N27O37S5Pureza:Min. 95%Peso molecular:2,515.76 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C185H268N48O51S2Pureza:Min. 95%Peso molecular:4,044.53 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H71ClN12O8S2Pureza:Min. 95%Peso molecular:1,175.86 g/mol5-FAM-Woodtide trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C89H133N21O26SPureza:Min. 95%Peso molecular:1,945.2 g/molQuinoline-4-carboxylic acid
CAS:<p>Quinoline-4-carboxylic acid is a natural compound that is derived from the amino acid tryptophan. It has been shown to have antiinflammatory activity and to be an inhibitor of prostaglandin synthesis. Quinoline-4-carboxylic acid inhibits the growth of carcinoma cells in culture by inducing apoptosis, which is mediated by inhibition of protein synthesis. Quinoline-4-carboxylic acid also has pharmacokinetic properties, including a low volume of distribution, low clearance rate and high bioavailability.</p>Fórmula:C10H7NO2Pureza:Min. 97 Area-%Peso molecular:173.17 g/molH-His-His-OH trifluoroacetate salt
CAS:<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>Fórmula:C12H16N6O3Pureza:Min. 95%Peso molecular:292.29 g/molRhodanine-N-acetic acid
CAS:<p>Rhodanine-N-acetic acid is a model system for antimicrobial agents. It is an acidic molecule with low light absorption and can be used as a chemotherapeutic agent. Rhodanine-N-acetic acid has been shown to have high resistance to bacteria in vitro, making it effective against malonic acid, which is the main cause of infection. Rhodanine-N-acetic acid has been shown to have biological properties, such as photophysical and redox potentials that make it suitable for use in vivo. Rhodanine-N-acetic acid also has photocurrent and electrochemical impedance spectroscopy characteristics that may be used to measure its activity in vivo.</p>Fórmula:C5H5NO3S2Pureza:Min. 95%Peso molecular:191.23 g/molAbz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C62H71N11O18Pureza:Min. 95%Peso molecular:1,258.29 g/molVinylboronic acid MIDA ester
CAS:<p>Vinylboronic acid MIDA ester is a boronic ester that can be used as an additive to control weeds. It is a mixture of two diastereomers, with the vinyl group on one end of the molecule and the boron atom on the other. Vinylboronic acid MIDA ester has been shown to be more effective than methoxy for weed control, with yields of up to 100%. The addition of this compound to herbicides increases their activity against weeds, which may be due to its ability to increase the solubility of active ingredients.</p>Fórmula:C7H10BNO4Pureza:Min. 95%Peso molecular:182.97 g/molH-Arg-Ile-OH acetate salt
CAS:<p>H-Arg-Ile-OH acetate salt is a regulatory protein that is found in plant cells. It has been shown to be involved in the regulation of cancer, as well as having some anti-inflammatory activities. H-Arg-Ile-OH acetate salt also has been shown to inhibit the production of fatty acids and coagulation factors by inhibiting serine proteases and thromboplastin activity, respectively. H-Arg-Ile-OH acetate salt may have an important role in regulating blood clotting by preventing fibrinogen from converting to fibrin, which leads to clot formation.</p>Fórmula:C12H25N5O3Pureza:Min. 95%Peso molecular:287.36 g/molAmyloid β-Protein (3-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C187H285N51O54SPureza:Min. 95%Peso molecular:4,143.64 g/molFmoc-L-aspartic acid β-allyl ester
CAS:<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>Fórmula:C22H21NO6Pureza:Min. 95%Peso molecular:395.41 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Amyloid β-Protein (20-29) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (20-29) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H66N12O17Pureza:Min. 95%Peso molecular:1,023.05 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C22H34N8O7Pureza:Min. 95%Peso molecular:522.56 g/molDocosahexaenoic acid ethyl ester
CAS:<p>Docosahexaenoic acid ethyl ester (DHAEE) is a biologically active form of docosahexaenoic acid (DHA), which is an omega-3 polyunsaturated fatty acid. DHAEE is synthesized from DHA through the process of acylation with ethanol. It has been shown to have antioxidant and anti-inflammatory properties in animal studies, as well as improved brain functions. When given to rats, it prevents neuronal death and has been shown to reduce the risk of congestive heart failure.</p>Fórmula:C24H36O2Pureza:Min. 95%Cor e Forma:Colorless Yellow Clear LiquidPeso molecular:356.54 g/mol(D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C63H79N13O12Pureza:Min. 95%Peso molecular:1,210.38 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C221H368N72O66SPureza:Min. 95%Peso molecular:5,121.8 g/mol(Tyr1)-TRAP-7 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H67N11O10Pureza:Min. 95%Peso molecular:922.08 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C91H129N25O25SPureza:Min. 95%Peso molecular:2,005.22 g/molZ-L-α-aminobutyric acid
CAS:<p>Z-L-alpha-aminobutyric acid is a homogeneous, optically active, linear phosphinic analogue of alpha-aminobutyric acid. It has been used in the synthesis of phosphinic analogues of cyclosporin and undecapeptides with high yields. The coupling reaction between Z-L-alpha-aminobutyric acid and benzaldehyde was carried out in two steps to produce the desired product. A stepwise condensation between Z-L-alpha-aminobutyric acid and 3,4,5,6 tetrahydropyrimidine was also successful.</p>Fórmula:C12H15NO4Pureza:Min. 98 Area-%Cor e Forma:White PowderPeso molecular:237.25 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS:<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C63H84N20O13Pureza:Min. 95%Peso molecular:1,329.47 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H21BO3Pureza:Min. 95%Peso molecular:248.13 g/molAcetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C205H333N63O54SPureza:Min. 95%Peso molecular:4,576.3 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H37N5O4•3C2H4O2Pureza:Min. 95%Peso molecular:567.67 g/molγ-Polyglutamic acid sodium - MW 800-1500
CAS:<p>Polymer of glutamic acid</p>Fórmula:(C5H9NO3)nPureza:Min. 95%Cor e Forma:Powder(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C50H78N14O19Pureza:Min. 95%Peso molecular:1,179.24 g/molIntermedin-53 (human) trifluoroacetate salt
<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C247H395N83O73S3Pureza:Min. 95%Peso molecular:5,791.49 g/molMethyl 2-bromo-2-(4-chlorophenyl)acetate
CAS:<p>2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.</p>Fórmula:C9H8BrClO2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:263.52 g/mol12-Doxyl stearic acid
CAS:<p>12-Doxyl stearic acid is a fatty acid that inhibits the vasoactive intestinal peptide (VIP). The inhibitory effect of 12-Doxyl stearic acid on VIP was demonstrated by incubating the cells with this fatty acid and measuring the change in mitochondrial Ca2+ concentration. This inhibition was shown to be due to the inhibition of fatty acids and not an effect on Ca2+ ion channels. Fatty acids are important for normal cellular function, such as maintaining membrane fluidity and aiding in signal transduction. 12-Doxyl stearic acid has been shown to inhibit the production of cardiac fatty acids and may be useful in treating cardiac disorders. 12-Doxyl stearic acid also has a fluorescence probe that can be used to study how cells react to different conditions, such as changes in water vapor or pH levels.</p>Fórmula:C22H42NO4Pureza:Min. 95%Cor e Forma:Yellow Clear LiquidPeso molecular:384.57 g/mol(H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt
CAS:<p>Please enquire for more information about (H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H66N10O23Pureza:Min. 95%Peso molecular:1,247.18 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C63H113N22O25PSPureza:Min. 95%Peso molecular:1,641.74 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H300N56O56SPureza:Min. 95%Peso molecular:4,356.88 g/molMagnesium acetate anhydrous
CAS:<p>Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.</p>Fórmula:C4H6MgO4Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:142.39 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C49H68N14O15Pureza:Min. 95%Peso molecular:1,093.15 g/mol2-Hydroxysuccinic acid methyl ester
CAS:<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>Fórmula:C5H8O5Pureza:90% MinPeso molecular:148.11 g/molSpexin trifluoroacetate salt
CAS:<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C74H114N20O19SPureza:Min. 95%Peso molecular:1,619.89 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS:<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>Fórmula:C7H8N2O2·xHClPureza:(%) Min. 60%Cor e Forma:PowderPeso molecular:188.61 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS:<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Fórmula:C15H23N5O4Pureza:Min. 95%Peso molecular:337.37 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Fórmula:C38H63N7O8Pureza:Min. 95%Peso molecular:745.95 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C116H176N26O30S2Pureza:Min. 95%Peso molecular:2,478.93 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C29H45N11O8Pureza:Min. 95%Peso molecular:675.74 g/molGLP-2 (1-34) (human) trifluoroacetate salt
CAS:<p>Structure/Function: human; Trifluoroacetate salt</p>Fórmula:C171H266N48O56SPureza:Min. 95%Peso molecular:3,922.3 g/molAmyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H81N17O16Pureza:Min. 95%Peso molecular:1,104.22 g/mol3-Maleimidophenyl boronic acid
CAS:<p>Please enquire for more information about 3-Maleimidophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H8NO4BPureza:Min. 95%Peso molecular:216.99 g/mol2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid
CAS:<p>Please enquire for more information about 2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C7H5BF2O4Pureza:Min. 95%Peso molecular:201.92 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C42H62N14O16SPureza:Min. 95%Peso molecular:1,051.09 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Fórmula:C12H19NO5Pureza:Min. 95%Peso molecular:257.28 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Fórmula:C30H44N8O4Pureza:Min. 95%Peso molecular:580.72 g/molD-Aspartic acid
CAS:<p>D-Aspartic acid is a basic protein that binds to glutamate. It has been shown to be effective in the prevention and treatment of bone cancer in mice. D-Aspartic acid also has an inhibitory effect on the production of estradiol benzoate, which is an enzyme responsible for bone resorption. D-Aspartic acid may also be used as a dietary supplement for bowel disease and bowel motility.<br>D-Aspartic acid has been shown to have receptor activity in humans and to have physiological effects on the locomotor activity of rats. The complex enzyme d-aspartate oxidase can be inhibited by d-aspartic acid.</p>Fórmula:C4H7NO4Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:133.1 g/molConjugated linoleic acid - liquid
CAS:<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>Fórmula:C18H32O2Pureza:Min. 95%Cor e Forma:Slightly Yellow Clear LiquidPeso molecular:280.45 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Fórmula:C148H239ClN44O42Pureza:Min. 95%Peso molecular:3,342.21 g/molRVG-9R trifluoroacetate salt
CAS:<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C201H334N82O55S2Pureza:Min. 95%Peso molecular:4,843.45 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Fórmula:C28H34N4O7SPureza:Min. 95%Peso molecular:570.66 g/molHemimellitic acid
CAS:<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>Fórmula:C9H6O6Pureza:Min. 95%Cor e Forma:White To Off-White SolidPeso molecular:210.14 g/mol(Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pen 5)-Urotensin II (4-11) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C52H68N10O12S2Pureza:Min. 95%Peso molecular:1,089.29 g/mol3-Hydroxy-4-methyl-2-nitro-benzoic acid
CAS:<p>3-Hydroxy-4-methyl-2-nitrobenzoic acid is an analog of the natural substrate for the enzyme nitroreductase. It can be used in oxidative coupling reactions to generate a covalently bonded product, which is immobilized on sepharose. 3-Hydroxy-4-methyl-2-nitrobenzoic acid has a high affinity for nucleic acids and can be used in biospecific assays. The chromophore of 3-hydroxy-4-methyl-2-nitrobenzoic acid is easily oxidized, leading to its use in nitroreduction reactions in which a nitro group is reduced to an amino group.</p>Pureza:Min. 95%Di-tert-butyl azodicarboxylate
CAS:<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>Fórmula:C10H18N2O4Pureza:Min. 98%Cor e Forma:PowderPeso molecular:230.26 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C247H361N57O80S2Pureza:Min. 95%Peso molecular:5,472.98 g/molBiotinyl-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C153H258N52O44S5Pureza:Min. 95%Peso molecular:3,690.34 g/molTRAP-14 trifluoroacetate salt
CAS:<p>TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.</p>Fórmula:C81H118N20O23Pureza:Min. 95%Peso molecular:1,739.92 g/molAc-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>Fórmula:C30H46N10O6•C2HF3O2Pureza:Min. 96 Area-%Cor e Forma:PowderPeso molecular:756.77 g/mol2-[(3,5,6-Trichloro-2-pyridinyl)oxy]acetic acid
CAS:<p>Carbaryl is a broad-spectrum insecticide that has been used to control pests in homes, gardens, and agricultural fields. It can be found in many products for use around the home, including flea collars and ant traps. Carbaryl is absorbed by plants through their leaves and roots and can affect photosynthetic activity. Carbaryl also affects plant metabolism by inhibiting proximal tubule function, which leads to an increase in urea nitrogen and urine production. Carbaryl can be toxic to humans when ingested or inhaled. The toxicity of carbaryl depends on its route of exposure (oral, inhalation, or skin). Carbaryl is metabolized through a number of metabolic reactions that include oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.</p>Fórmula:C7H4Cl3NO3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:256.47 g/molEthyl 4-amino-2-mercaptopyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Ethyl 4-amino-2-mercaptopyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C7H9N3O2SPureza:Min. 95%Peso molecular:199.23 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Fórmula:C13H25NO7Pureza:Min. 95%Cor e Forma:Colorless PowderPeso molecular:307.34 g/molModafinil carboxylate
CAS:<p>Modafinil is a drug that belongs to the class of wakefulness-promoting agents. It has been shown to have a long half-life and low toxicity in humans, which may be due to its effects on cytochrome P450 isoenzymes. Modafinil has been studied in clinical trials for its tolerability, with no significant side effects reported. The drug has also been shown to have anticonvulsant properties and can be used as an adjunctive treatment for patients with partial seizures. Modafinil binds to the GABA receptor in the brain and increases GABAergic neurotransmission. The compound's mechanism of action is not fully understood, but it is believed that it acts by inhibiting cyclic AMP degradation and increasing cAMP levels in the brain. This increase in cAMP levels may lead to increased protein kinase activity, decreased phosphorylation of glutamate receptors, increased release of dopamine, and decreased release of histamine from mast cells.</p>Fórmula:C15H14O3SPureza:Min. 95%Cor e Forma:PowderPeso molecular:274.34 g/molCyclohexylacetic acid
CAS:<p>Cyclohexylacetic acid is a cyclic fatty acid that has been shown to inhibit the production of gamma-aminobutyric acid in hl-60 cells. This inhibition leads to an increase in epidermal growth factor and a decrease in malonic acid. Cyclohexylacetic acid also inhibits microbial metabolism by preventing the conversion of nitrogen atoms into ammonia, which can cause cardiac arrest or sublethal doses. The effects of cyclohexylacetic acid on coronary heart disease have not been determined because it is not commercially available for purchase.</p>Fórmula:C8H14O2Pureza:Min. 95%Peso molecular:142.2 g/molFmoc-L-α-aminobutyric acid
CAS:<p>Fmoc-L-alpha-aminobutyric acid is a synthetic amino acid that is used as a linker in solid-phase peptide synthesis. It is also used to synthesize analogs of the serine protease NS3, which are postulated to inhibit hepatitis C virus replication by preventing the release of viral RNA from infected cells. Fmoc-L-alpha-aminobutyric acid has been shown to have anti-viral activity against the influenza virus and HIV.</p>Fórmula:C19H19NO4Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:325.36 g/molH-Asn-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H15N3O4Pureza:Min. 95%Peso molecular:289.29 g/molFITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt
<p>Please enquire for more information about FITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C230H333N57O66S2Pureza:Min. 95%Peso molecular:5,016.58 g/mol1,3-Dithiane-2-carboxylic acid
CAS:<p>1,3-Dithiane-2-carboxylic acid is an alkylating agent that reacts with electron-deficient substrates. It is a convenient way to access enantiopure carboxylates and unsaturated ketones in the presence of amines. This compound can also be used for the preparation of phthalimides and thioacetals. 1,3-Dithiane-2-carboxylic acid is prepared by ring opening of 1,3 dithianes. This reaction can be catalyzed by acids such as hydrochloric acid or pyridine.</p>Fórmula:C5H8O2S2Pureza:Min. 95%Peso molecular:164.25 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C196H288N56O56SPureza:Min. 95%Peso molecular:4,356.79 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C95H160N34O27Pureza:Min. 95%Peso molecular:2,210.5 g/molTRAF6 Control Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAF6 Control Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C139H232N34O42Pureza:Min. 95%Peso molecular:3,051.53 g/molDL-3-Amino-3-phenylpropionic acid
CAS:<p>DL-3-Amino-3-phenylpropionic acid is an amino acid that is synthesized by the reaction of malonic acid and ethyl ester. This compound is a competitive inhibitor of the enzyme pyruvate carboxylase and inhibits this enzyme in the conversion of pyruvic acid to acetyl CoA, which plays a key role in metabolism. DL-3-Amino-3-phenylpropionic acid has been shown to inhibit the growth of bacteria such as Escherichia coli, Salmonella typhimurium and Staphylococcus aureus. The inhibition of pyruvate carboxylase by DL-3-Amino-3-phenylpropionic acid prevents the production of acetaldehyde from pyruvate, which is toxic to cells.</p>Fórmula:C9H11NO2Pureza:Min. 95%Peso molecular:165.19 g/molAmylin (human) trifluoroacetate salt
CAS:<p>Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.</p>Fórmula:C165H261N51O55S2Pureza:Min. 95%Peso molecular:3,903.28 g/molCatestatin (human) trifluoroacetate
CAS:<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C104H164N32O27SPureza:Min. 95%Peso molecular:2,326.68 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS:<p>Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.</p>Fórmula:C124H180N34O31Pureza:Min. 95%Peso molecular:2,642.97 g/molIndole-3-acetic-L-alanine
CAS:<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>Fórmula:C13H14N2O3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:246.26 g/mol16-Mercaptohexadecanoic acid
CAS:<p>16-Mercaptohexadecanoic acid (16MHDA) is a fatty acid that has been shown to be an effective inhibitor of the enzyme fatty acid synthase. This enzyme is responsible for the synthesis of long-chain polyunsaturated fatty acids and their derivatives, which are key components of cell membranes and also act as signaling molecules. 16MHDA can be used in the treatment of diseases such as psoriasis, rheumatoid arthritis, and cancer. 16MHDA has been shown to have a high detection sensitivity and activity index when used in electrochemical impedance spectroscopy experiments. The x-ray diffraction data show that 16MHDA forms an acid complex with its substrate, which is thought to be the reaction mechanism. Colloidal gold has been used to study the interaction between 16MHDA and DNA duplexes. This compound was also found to have monoclonal antibody binding properties in human serum samples.</p>Fórmula:C16H32O2SPureza:Min. 95%Cor e Forma:PowderPeso molecular:288.49 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C78H107N21O18Pureza:Min. 95%Peso molecular:1,626.81 g/molNeurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt
CAS:<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>Fórmula:C78H121N21O20Pureza:Min. 95%Peso molecular:1,672.92 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C68H107N19O17SPureza:Min. 95%Peso molecular:1,494.76 g/molM65 trifluoroacetate salt
<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C205H326N64O61S5Pureza:Min. 95%Peso molecular:4,823.51 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C62H83N17O13Pureza:Min. 95%Cor e Forma:PowderPeso molecular:1,274.43 g/mol(Asp28)-Exenatide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H281N49O61SPureza:Min. 95%Peso molecular:4,187.56 g/molpTH (7-84) (human) trifluoroacetate salt
<p>Please enquire for more information about pTH (7-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C381H629N119O115S2Pureza:Min. 95%Peso molecular:8,780.94 g/mol2-Hydroxyethanesulfonic acid sodium salt
CAS:<p>2-Hydroxyethanesulfonic acid sodium salt is a drug that is used to treat metabolic disorders such as cystinuria and hyperchloremic metabolic acidosis. It is also used for the treatment of water-vapor related respiratory problems and cataracts, as well as for the prevention of renal stone formation. This drug is made through electrochemical impedance spectroscopy of taurine in reaction solution with phosphorus pentoxide. 2-Hydroxyethanesulfonic acid sodium salt has been shown to increase locomotor activity in rats by improving their biochemical properties. This compound binds to the chloride ion receptor site on the Na+/K+ ATPase, causing an inhibition of the enzyme's function.</p>Fórmula:C2H5O4S·NaPureza:Min. 95%Cor e Forma:White PowderPeso molecular:148.11 g/molAF-16 trifluoroacetate salt
CAS:<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Fórmula:C71H119N25O25SPureza:Min. 95%Peso molecular:1,754.92 g/molSalusin-β (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C115H176N32O21Pureza:Min. 95%Peso molecular:2,342.83 g/molAmyloid β-Protein (1-37) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-37) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C182H274N50O55SPureza:Min. 95%Peso molecular:4,074.49 g/molCART (62-76) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (62-76) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H99N17O23S3Pureza:Min. 95%Peso molecular:1,570.77 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:<p>Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.</p>Fórmula:C34H41N3O6Pureza:Min. 95%Peso molecular:587.71 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:<p>4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.</p>Fórmula:C9H9BrN2O3Pureza:(Elemental Analysis) Min. 97%Cor e Forma:PowderPeso molecular:273.08 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H102N18O26S4Pureza:Min. 95%Peso molecular:1,667.86 g/molVIP sulfoxide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C147H238N44O43SPureza:Min. 95%Peso molecular:3,341.8 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Fórmula:C8H8O4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:168.15 g/molGalanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C139H210N42O43Pureza:Min. 95%Peso molecular:3,157.41 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS:<p>Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.</p>Fórmula:C5H11NS2•Na•(H2O)3Pureza:Min. 95%Cor e Forma:PowderPeso molecular:226.32 g/molCell-permeable Caspase-3 Inhibitor I trifluoroacetate salt
CAS:<p>Please enquire for more information about Cell-permeable Caspase-3 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C94H158N20O27Pureza:Min. 95%Peso molecular:2,000.38 g/molBiotinyl-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C177H286N54O55S3Pureza:Min. 95%Peso molecular:4,146.69 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C53H106N30O11Pureza:Min. 95%Peso molecular:1,339.6 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C80H138N26O24S2Pureza:Min. 95%Peso molecular:1,912.24 g/mol2,5-Diaminoterephthalic acid
CAS:<p>2,5-Diaminoterephthalic acid is a synthetic organic compound that is used as a building block for the synthesis of polyamides. It has been shown to have high salt adsorption properties and low detection limits for certain analytes. 2,5-Diaminoterephthalic acid has also been found to have photocatalytic activity and can be used in the treatment of cancer. This chemical reacts with nitro groups on nucleophilic attack to form the carcinogenic nitrosamine. The formation rate of this nitrosamine depends on the presence of methoxy groups and nitrogen atoms in 2,5-diaminoterephthalic acid.</p>Fórmula:C8H8N2O4Pureza:Min. 95%Peso molecular:196.16 g/molPentafluoropropionic acid
CAS:<p>Pentafluoropropionic acid is a glycol ether that is used in the preparation of coumarin derivatives. It reacts with sodium carbonate and trifluoroacetic acid to form the corresponding acyl chloride, which then reacts with nitrogen atoms (e.g., ammonia) to form an amide or urea derivative. Pentafluoropropionic acid also reacts with hydrogen fluoride to form pentafluoropropane and hydrogen fluoride gas, which can be used as a propellant for aerosol sprays. Pentafluoropropionic acid binds to toll-like receptors on cancer cells and human serum, inhibiting their ability to synthesize DNA. The compound has been shown to inhibit tumor growth in mice by blocking the formation of cancer tissues.</p>Fórmula:C3HF5O2Pureza:Min. 95%Cor e Forma:Clear LiquidPeso molecular:164.03 g/molDnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H64N14O11Pureza:Min. 95%Peso molecular:977.08 g/molN-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid
CAS:<p>N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid is a high quality chemical that is used as an intermediate in the production of pharmaceuticals and other fine chemicals. It is also a reagent for use in peptide synthesis. N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid has a CAS No. 669073-62-5 and can be used as a useful scaffold for the production of complex compounds. This compound is also useful for research purposes, due to its versatility as a building block with speciality chemical applications.</p>Fórmula:C23H26N2O6Pureza:Min. 95%Peso molecular:426.46 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H285N55O57SPureza:Min. 95%Peso molecular:4,271.69 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Fórmula:C141H235N47O41Pureza:Min. 95%Peso molecular:3,244.67 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C42H74N10O12SPureza:Min. 95%Peso molecular:943.16 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H84N16O12Pureza:Min. 95%Peso molecular:1,209.4 g/mol(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C120H206N44O35SPureza:Min. 95%Peso molecular:2,857.26 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS:<p>Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H17BN2O2Pureza:Min. 95%Peso molecular:208.07 g/mol(Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (25-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C46H83N13O14Pureza:Min. 95%Peso molecular:1,042.23 g/mol4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H33BN2O4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:388.31 g/mol(R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate
CAS:<p>Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H17NO3Pureza:Min. 95%Cor e Forma:Clear LiquidPeso molecular:199.25 g/molPeptide YY (3-36) trifluoroacetate salt
CAS:<p>Peptide YY (PYY) is a 36-amino acid peptide. It is cleaved from the larger protein, pancreatic polypeptide, by the enzyme dipeptidyl peptidase IV and circulates in plasma as PYY(3-36). The postprandial plasma levels of PYY are dose-dependent and increase with increasing doses of injected PYY. This response reflects the physiological effects of this hormone. A linear regression analysis revealed that PYY(3-36) has a significant effect on body weight loss and body mass index in humans. The effective dose for weight loss is yet to be determined, but it may be higher than 10 μg/kg/day.</p>Fórmula:C176H272N52O54Pureza:Min. 95%Peso molecular:3,980.36 g/molH-Ile-NHOH acetate salt
CAS:<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>Fórmula:C6H14N2O2Pureza:Min. 95%Peso molecular:146.19 g/mol(R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (R)-3-[((tert-Butoxy)carbonyl)amino]-4-(2,5-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H19F2NO4Pureza:Min. 95%Peso molecular:315.31 g/mol(D-Trp11)-Neurotensin acetate salt
CAS:<p>Acetate salt</p>Fórmula:C80H122N22O19Pureza:Min. 95%Peso molecular:1,695.96 g/mol2,4,6-Trifluorobenzoic acid
CAS:<p>2,4,6-Trifluorobenzoic acid is a chemical compound that is an intermediate in the synthesis of stilbazole. It is prepared by chlorinating the 2,4,6-trichlorobenzoic acid with hydrogen peroxide and hydrochloric acid. The 2,4,6-trifluorobenzoic acid is then reduced to the desired product with sodium borohydride. This chemical has been detected in nature as a racemic mixture and can be used as a precursor in analytical methods for detecting other compounds. It is also used in dechlorination reactions to remove chlorine from organic molecules. This process can be monitored using UV detectors.</p>Fórmula:C7H3F3O2Pureza:Min. 95%Peso molecular:176.09 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C120H179N35O28SPureza:Min. 95%Peso molecular:2,591.99 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C107H170N32O21Pureza:Min. 95%Peso molecular:2,240.7 g/mol
