CAS 197922-42-2

Teduglutid

Beschreibung:

Teduglutid ist ein synthetisches Analogon des menschlichen glucagonähnlichen Peptids-2 (GLP-2), eines Hormons, das an der Regulierung des intestinalen Wachstums und der Funktion beteiligt ist. Es wird hauptsächlich zur Behandlung des Kurzdarmsyndroms eingesetzt, einer Erkrankung, die nach der chirurgischen Entfernung eines erheblichen Teils des Darms auftreten kann. Teduglutid fördert die intestinale Absorption von Nährstoffen und Flüssigkeiten und verbessert somit die Lebensqualität der Patienten mit dieser Erkrankung. Der Stoff wird durch subkutane Injektion verabreicht und hat aufgrund seiner Resistenz gegen enzymatische Zersetzung eine relativ lange Halbwertszeit. Sein Wirkmechanismus beinhaltet die Bindung an den GLP-2-Rezeptor, was zu einem verbesserten Wachstum der Darmschleimhaut, einer erhöhten Zottenhöhe und einer verbesserten Nährstoffaufnahme führt. Häufige Nebenwirkungen können gastrointestinale Symptome wie Übelkeit und Bauchschmerzen sowie potenzielle Risiken für Neoplasien aufgrund seiner wachstumsfördernden Wirkungen umfassen. Insgesamt stellt Teduglutid einen bedeutenden Fortschritt im Management des Kurzdarmsyndroms dar und bietet den Patienten einen verbesserten Ernährungszustand und eine reduzierte Abhängigkeit von parenteraler Unterstützung.

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Synonyme:

• Alx 0600

ALX 0600

CAS: 197922-42-2

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Reinheit: 98%

Farbe und Form: Solid

Molekulargewicht: 3752.0825

Ref: IN-DA00ACKN

Teduglutide

CAS: 197922-42-2

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Molekulargewicht: 3752.13

Ref: 4Z-PT-312001

Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)

Kontrolliertes Produkt

CAS: 197922-42-2

Applications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)

Formel: C₁₆₄H₂₄₄D₈N₄₄O₅₅S•C₂HF₃O₂•x(H₂O)

Farbe und Form: Neat

Molekulargewicht: 3760.081140218

Ref: TR-T013798

Teduglutide

CAS: 197922-42-2

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Reinheit: 98.08%

Farbe und Form: Solid

Molekulargewicht: 3752.08

Ref: TM-T35337

Teduglutide

CAS: 197922-42-2

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Reinheit: Min. 95%

Molekulargewicht: 3,752.16 g/mol

Ref: 3D-TED-3880-PI

Teduglutide (GLP2 2G)

CAS: 197922-42-2

Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Farbe und Form: Powder

Molekulargewicht: 3,749.8 g/mol

Ref: 3D-CRB1000390

Teduglutide trifluoroacetate

CAS: 197922-42-2

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formel: C₁₆₄H₂₅₂N₄₄O₅₅S

Molekulargewicht: 3,752.08 g/mol

Ref: 3D-PP50564