CAS 197922-42-2
:Teduglutid
Beschreibung:
Teduglutid ist ein synthetisches Analogon des menschlichen glucagonähnlichen Peptids-2 (GLP-2), eines Hormons, das an der Regulierung des intestinalen Wachstums und der Funktion beteiligt ist. Es wird hauptsächlich zur Behandlung des Kurzdarmsyndroms eingesetzt, einer Erkrankung, die nach der chirurgischen Entfernung eines erheblichen Teils des Darms auftreten kann. Teduglutid fördert die intestinale Absorption von Nährstoffen und Flüssigkeiten und verbessert somit die Lebensqualität der Patienten mit dieser Erkrankung. Der Stoff wird durch subkutane Injektion verabreicht und hat aufgrund seiner Resistenz gegen enzymatische Zersetzung eine relativ lange Halbwertszeit. Sein Wirkmechanismus beinhaltet die Bindung an den GLP-2-Rezeptor, was zu einem verbesserten Wachstum der Darmschleimhaut, einer erhöhten Zottenhöhe und einer verbesserten Nährstoffaufnahme führt. Häufige Nebenwirkungen können gastrointestinale Symptome wie Übelkeit und Bauchschmerzen sowie potenzielle Risiken für Neoplasien aufgrund seiner wachstumsfördernden Wirkungen umfassen. Insgesamt stellt Teduglutid einen bedeutenden Fortschritt im Management des Kurzdarmsyndroms dar und bietet den Patienten einen verbesserten Ernährungszustand und eine reduzierte Abhängigkeit von parenteraler Unterstützung.
Formel:C164H252N44O55S
Synonyme:- Alx 0600
Sortieren nach
Reinheit (%)
0
100
|
0
|
50
|
90
|
95
|
100
8 Produkte gefunden.
Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)
CAS:Kontrolliertes ProduktApplications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)Formel:C164H244D8N44O55S•C2HF3O2•x(H2O)Farbe und Form:NeatMolekulargewicht:3760.081140218Teduglutide
CAS:Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).Formel:C164H252N44O55SReinheit:98.08%Farbe und Form:White SolidMolekulargewicht:3752.08Teduglutide
CAS:Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITDFormel:C164H252N44O55SReinheit:Min. 95%Molekulargewicht:3,752.16 g/molTeduglutide (GLP2 2G)
CAS:Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.Formel:C164H252N44O55SFarbe und Form:PowderMolekulargewicht:3,749.8 g/molTeduglutide trifluoroacetate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formel:C164H252N44O55SMolekulargewicht:3,752.08 g/mol






