
Receptor de glucagón
Los receptores de glucagón son GPCR que median los efectos del glucagón, una hormona involucrada en la regulación de la homeostasis de la glucosa al promover la descomposición del glucógeno y la liberación de glucosa desde el hígado. Estos receptores son cruciales en la gestión de los niveles de azúcar en sangre y son de particular interés en el estudio de la diabetes y los trastornos metabólicos. Los antagonistas de los receptores de glucagón se están explorando como posibles tratamientos para la hiperglucemia en la diabetes tipo 2. En CymitQuimica, ofrecemos una variedad de moduladores de receptores de glucagón de alta calidad para apoyar su investigación en endocrinología, diabetes y regulación metabólica.
Se han encontrado 164 productos de "Receptor de glucagón"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Crotedumab
CAS:<p>Crotedumab (REGN1193) is a humanized antibody targeting GCGR, which reduces fasting blood glucose and improves glucose tolerance, used in diabetes research.</p>Pureza:>95%Forma y color:LiquidVolagidemab
CAS:<p>Anti-CD34 Antibody is a CHO-expressed humanized monoclonal antibody targeting CD34, which can be used for the study of neurological and cardiovascular diseases.</p>Pureza:97.8% (SDS-PAGE); 98% (SEC-HPLC) - 97.8% (SDS-PAGE); 98% (SEC-HPLC)Forma y color:LiquidGlucagon (1-29), bovine, human, porcine hydrochloride
CAS:<p>Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.</p>Fórmula:C153H225N43O49S·ClHPureza:95.65% - 98.03%Forma y color:SolidPeso molecular:3519.21Retatrutide sodium salt
<p>Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.</p>Pureza:99.97%Forma y color:SoildPF-06882961
CAS:<p>PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Fórmula:C31H30FN5O4Pureza:98.06% - 99.54%Forma y color:SolidPeso molecular:555.6Tirzepatide monosodium salt
<p>Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.</p>Fórmula:C225H347N48O68NaPureza:99.69%Forma y color:SoildPeso molecular:4835.51Retatrutide
CAS:<p>Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.</p>Fórmula:C221H342N46O68Pureza:98.31%Forma y color:SolidPeso molecular:4732.09Avexitide acetate
CAS:<p>Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.</p>Fórmula:C155H246N40O53SPureza:96.64% - 98.65%Forma y color:SolidPeso molecular:3549.91(S, R)-LSN 3318839
CAS:<p>(S,R)-LSN 3318839 enhances GLP-1R, shows strong blood sugar lowering in animals, works with sitagliptin.</p>Fórmula:C26H23Cl2N3O2Pureza:99.57%Forma y color:SoildPeso molecular:480.39GLP-1R Agonist DMB
CAS:<p>GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).</p>Fórmula:C13H15Cl2N3O2SPureza:99.52%Forma y color:SolidPeso molecular:348.25GLP-1R Antagonist 1
CAS:<p>GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).</p>Fórmula:C16H11ClF6N4O2Pureza:99.84%Forma y color:SolidPeso molecular:440.73HAEGTFTSD
CAS:<p>HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.</p>Fórmula:C40H57N11O17Pureza:98%Forma y color:SolidPeso molecular:963.94Tirzepatide
CAS:<p>Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.</p>Fórmula:C225H348N48O68Pureza:99.52% - 99.99%Forma y color:SolidPeso molecular:4813.45HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Fórmula:C20H31N7O9Pureza:98%Forma y color:SolidPeso molecular:513.5Glucagon receptor antagonists-1
CAS:<p>Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.</p>Fórmula:C29H34FNO2Pureza:98%Forma y color:SolidPeso molecular:447.58V-0219 hydrochloride
<p>V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.</p>Fórmula:C20H26ClF3N4O2Pureza:99.97%Forma y color:SoildPeso molecular:446.89Orforglipron
CAS:<p>Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1</p>Fórmula:C48H48F2N10O5Pureza:99.47% - 99.8%Forma y color:SolidPeso molecular:882.96GLP-1 moiety from Dulaglutide
<p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>Fórmula:C149H221N37O49Pureza:98%Forma y color:SolidPeso molecular:3314.62HAEGTFTSD acetate(926018-45-3 free base)
<p>HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from</p>Fórmula:C42H61N11O19Pureza:98%Forma y color:SolidPeso molecular:1024.01GLP-1 receptor agonist 13
<p>Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].</p>Fórmula:C25H23ClF2N6OForma y color:SolidPeso molecular:496.94Albiglutide Fragment
CAS:<p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>Fórmula:C148H224N40O45Pureza:98%Forma y color:SolidPeso molecular:3283.66α-Methylprednisolone 21-hemisuccinate sodium salt
CAS:<p>6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.</p>Fórmula:C26H33NaO8Pureza:99.65%Forma y color:Lyophilized PowderPeso molecular:496.53Cinnamtannin A2
CAS:<p>Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.</p>Fórmula:C60H50O24Forma y color:SolidPeso molecular:1155.02Tirzepatide hydrochloride
<p>Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.</p>Fórmula:C225H349N48O68ClPureza:98%Forma y color:SolidPeso molecular:4849.91Survodutide TFA
<p>Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.</p>Fórmula:C192H289N47O61·xC2HF3OC2Pureza:99.29% - 99.96%Forma y color:SolidPeso molecular:4231.62 (free base)Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Fórmula:C132H221N44F3O42Pureza:98%Forma y color:SolidPeso molecular:3153.48VU0453379
CAS:<p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>Fórmula:C26H34N4O2Pureza:98%Forma y color:SolidPeso molecular:434.57GLP-1 receptor agonist 4
CAS:<p>GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.</p>Fórmula:C51H44Cl2N4O6Pureza:98%Forma y color:SolidPeso molecular:879.82Glucagon (19-29), human
CAS:<p>Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.</p>Fórmula:C61H89N15O18SPureza:98%Forma y color:SolidPeso molecular:1352.53GLP-1R agonist 19
CAS:<p>GLP-1R agonist 19 (M3190) is a potent, selective GLP-1 receptor agonist that demonstrates excellent plasma and liver microsomal stability, along with low hERG toxicity [1].</p>Fórmula:C94H136FN21O25Forma y color:SolidPeso molecular:1979.21Peptide C105Y TFA
<p>Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.</p>Fórmula:C97H148N20O23S·xC2HF3O2Orforglipron hemicalcium hydrate
CAS:<p>Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) represents the hemicalcium hydrate form of the calcium salt of Orforglipron, an orally active agonist targeting the Glucagon-like peptide-1 receptor (GLP-1R). This compound has demonstrated efficacy in mitigating type 2 diabetes [1].</p>Fórmula:C48H48F2N10O5Ca·H2OForma y color:SolidPeso molecular:921.02Secretin (33-59), rat TFA
<p>Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates the secretin receptor, increasing pancreas secretion of bicarbonate, enzymes, and K+.</p>Fórmula:C131H217F3N42O44Forma y color:SolidPeso molecular:3141.37Ecnoglutide
CAS:<p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>Fórmula:C194H304N48O61Forma y color:SolidPeso molecular:4284.76GLP-1R/GIPR agonist-1
<p>GLP-1R/GIPR agonist-1 is a dual receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide). It mimics the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while suppressing glucagon release, thus lowering blood sugar. This compound is used in research related to metabolic disorders such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH).</p>Fórmula:C220H342N55O69Peso molecular:4858.49434GLP-1 receptor agonist 9 citrate
<p>GLP-1 receptor agonist 9 citrate is an agonist of GLP-1.</p>Fórmula:C38H39ClFN3O12Pureza:98.76%Forma y color:SolidPeso molecular:784.18GLP-1 (9-36) amide
CAS:<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Fórmula:C140H214N36O43Pureza:97%Forma y color:SolidPeso molecular:3089.41GLP-1(28-36)amide TFA
<p>GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.</p>Fórmula:C56H86F3N15O11Forma y color:SolidPeso molecular:1202.37GLP-1(9-36)amide TFA
<p>GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.</p>Fórmula:C142H215F3N36O45Forma y color:SolidPeso molecular:3203.43Anti-GLP1R Antibody
<p>Anti-GLP1R Antibody is a human antibody expressed in CHO cells, targeting GLP1R. For isotype controls, refer to Human IgG1 kappa, Isotype Control.</p>Forma y color:Odour LiquidUtreglutide
CAS:<p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>Fórmula:C191H298N46O58Forma y color:SolidPeso molecular:4166.67Bay 55-9837 TFA
<p>Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.</p>Fórmula:C150H240F3ClN44O44Forma y color:SolidPeso molecular:3456.22Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
<p>Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.</p>Fórmula:C165H252N44O48SForma y color:SolidPeso molecular:3652.1Tirzepatide TFA
<p>Tirzepatide TFA, a GIP and GLP-1 agonist, targets type 2 diabetes treatment.</p>Fórmula:C227H349F3N48O70Forma y color:SolidPeso molecular:4927.47Exendin-4 (3-39)
CAS:<p>Exendin-4 (3-39) is a truncated peptide missing first 2 amino acids of Exendin-4, a potent GLP-1r agonist used in diabetes and HPA axis research.</p>Fórmula:C176H272N46O58SForma y color:SolidPeso molecular:3992.44Glucagon-like peptide 1 (1-37), human
CAS:<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Fórmula:C186H275N51O59Pureza:98%Forma y color:SolidPeso molecular:4169.48Secretin (28-54), human
CAS:<p>Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.</p>Fórmula:C130H220N44O40Pureza:98%Forma y color:PowderPeso molecular:3039.46Albenatide
CAS:<p>Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.</p>Fórmula:C26H47N7O9SPureza:98%Forma y color:SolidPeso molecular:633.76HAEGTFTSDVS
CAS:<p>HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.</p>Fórmula:C48H71N13O20Pureza:98%Forma y color:SolidPeso molecular:1150.18Pal-Glu(OSu)-OH
CAS:<p>Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.</p>Fórmula:C25H42N2O7Forma y color:SolidPeso molecular:482.618TT-OAD2
CAS:<p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>Fórmula:C50H49Cl4N3O6Pureza:98%Forma y color:SolidPeso molecular:929.75GLP-2(1-33)(human)
CAS:GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Fórmula:C165H254N44O55SPureza:98%Forma y color:SolidPeso molecular:3766.19HAEGTFT
CAS:<p>HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.</p>Fórmula:C33H47N9O12Pureza:98%Forma y color:SolidPeso molecular:761.78GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Fórmula:C151H230N40O47Pureza:99.89%Forma y color:SolidPeso molecular:3357.68Apraglutide
CAS:<p>Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.</p>Fórmula:C172H263N43O52Pureza:98%Forma y color:SolidPeso molecular:3765.25Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Forma y color:SolidTaspoglutide
CAS:<p>Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetes</p>Fórmula:C152H232N40O45Pureza:98%Forma y color:SolidPeso molecular:3339.763LSN3160440
CAS:<p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>Fórmula:C27H27Cl2N3OForma y color:SolidPeso molecular:480.43Des His1, Glu8 Exendin-4
<p>Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.</p>Fórmula:C179H277N47O59SPureza:99.92%Forma y color:SolidPeso molecular:4063.46Secretin, porcine
CAS:<p>Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.</p>Fórmula:C130H220N44O41·xC2H4O2Pureza:98%Forma y color:SolidPeso molecular:N/ATT-OAD2 free base
CAS:<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Fórmula:C50H47Cl2N3O6Pureza:98%Forma y color:SolidPeso molecular:856.83{Val1}-Exendin-3/4
<p>{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.</p>Fórmula:NAPureza:98%Forma y color:SolidPeso molecular:3241.7GLP-1R agonist 14
CAS:<p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>Fórmula:C45H42F2N10O5Forma y color:SolidPeso molecular:840.88GIP/GLP-1 dual receptor agonist-1
CAS:<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Forma y color:SolidHAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Fórmula:C50H75N13O22Pureza:97.47%Forma y color:SolidPeso molecular:1210.2GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Forma y color:Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Fórmula:NAPureza:98%Forma y color:SolidPeso molecular:3055.49GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Fórmula:C151H228N40O47Pureza:98%Forma y color:SolidPeso molecular:3355.67Mazdutide acetate(2259884-03-0 free base)
<p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>Pureza:98.41%Forma y color:Odour SolidBay 55-9837
CAS:<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Fórmula:C167H270N52O46Pureza:98%Forma y color:SolidPeso molecular:3742.29Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Fórmula:C189H290F3N45O61Pureza:99.69%Forma y color:SolidPeso molecular:4225.6482Survodutide
CAS:<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Fórmula:C192H289N47O61Pureza:99.83%Forma y color:SolidPeso molecular:4229.0957VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Fórmula:C26H35ClN4O2Forma y color:SolidPeso molecular:471.033-Deoxyglucosone
CAS:<p>3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with protein</p>Fórmula:C6H10O5Pureza:95%Forma y color:SolidPeso molecular:162.14Sorbinicate
CAS:<p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>Fórmula:C42H32N6O12Pureza:98%Forma y color:SolidPeso molecular:812.74Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Fórmula:C148H224N40O45·xC2HF3O2Forma y color:Solid(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Fórmula:C20H26ClF3N4O2Forma y color:SolidPeso molecular:446.89Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Forma y color:LiquidOxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Fórmula:C192H295N59O60SPureza:98%Forma y color:SolidPeso molecular:4421.86GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Fórmula:C34H36ClFN6O4Forma y color:SolidPeso molecular:647.14[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Fórmula:C148H221N41O47SPureza:98%Forma y color:SolidPeso molecular:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Fórmula:C32H33N5O4SeForma y color:SolidPeso molecular:630.6(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Fórmula:C20H26ClF3N4O2Forma y color:SolidPeso molecular:446.89GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Fórmula:C46H47FN8O7SForma y color:SolidPeso molecular:874.98Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Forma y color:LiquidAnti-GLP-1R Antibody
<p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>Pureza:98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Forma y color:Odour LiquidSPN009
<p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>Fórmula:C191H299N45O59Peso molecular:4167.17798Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Fórmula:C188H276N51F3O61Pureza:98%Forma y color:SolidPeso molecular:4283.5GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Fórmula:C31H30Cl2F2N4O5Peso molecular:646.15613GLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Fórmula:C50H58FN10O6PForma y color:SolidPeso molecular:945.03GLP-1R agonist 4
CAS:<p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>Fórmula:C32H30ClF2N3O5Forma y color:SolidPeso molecular:610.05SAR441255
<p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>Forma y color:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Forma y color:SolidPeso molecular:3692.15Dapiglutide
CAS:<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Forma y color:SolidGRPP (human)
CAS:<p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>Fórmula:C136H215N41O58SForma y color:SolidPeso molecular:3384.47Glucagon (1-29), bovine, human, porcine
CAS:<p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>Fórmula:C153H225N43O49SPureza:99.56% - 99.56%Forma y color:SolidPeso molecular:3482.75GLP-1 receptor agonist 7
CAS:<p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>Fórmula:C31H30ClFN4O5Forma y color:SolidPeso molecular:593.05GLP-1 receptor agonist 2
CAS:<p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Fórmula:C30H31ClFN5O4Forma y color:SolidPeso molecular:580.05V-0219
CAS:<p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>Fórmula:C20H25F3N4O2Pureza:99.91%Forma y color:SoildPeso molecular:410.43GLP-1R modulator C16
CAS:<p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>Fórmula:C21H26ClFN2O3Pureza:99.6% - >99.99%Forma y color:SolidPeso molecular:408.89

