Compuestos y reactivos bioquímicos
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(98.563 productos)
- Por objetivo biológico(101.038 productos)
- Según efectos farmacológicos(6.954 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(531 productos)
- Biología Vegetal(6.903 productos)
- Metabolitos secundarios(14.368 productos)
Se han encontrado 130636 productos de "Compuestos y reactivos bioquímicos"
TM9SF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TM9SF1 antibody, catalog no. 70R-9642
Pureza:Min. 95%NOV Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NOV antibody, catalog no. 70R-1714
Pureza:Min. 95%C19orf25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf25 antibody, catalog no. 70R-8036
Pureza:Min. 95%TAF15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAF15 antibody, catalog no. 70R-4631
Pureza:Min. 95%PLA2G5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLA2G5 antibody, catalog no. 70R-5272
Pureza:Min. 95%SLC26A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A5 antibody, catalog no. 70R-1782
Pureza:Min. 95%C8orf45 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C8orf45 antibody, catalog no. 70R-9222
Pureza:Min. 95%RAGE Blocking Peptide
The RAGE Blocking Peptide is a powerful tool for researchers in the field of Life Sciences. This peptide is designed to block the activity of the Receptor for Advanced Glycation Endproducts (RAGE), a key player in various biological processes. By inhibiting RAGE, this peptide can help elucidate the role of RAGE in cholinergic signaling, growth factor regulation, and thrombocytopenia.
Pureza:Min. 95%PARP11 antibody
PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
Rat Fibronectin ELISA Kit
ELISA kit for detection of Fibronectin in the research laboratory
Pureza:Min. 95%
