Compuestos y reactivos bioquímicos
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(98.560 productos)
- Por objetivo biológico(101.036 productos)
- Según efectos farmacológicos(6.953 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(531 productos)
- Biología Vegetal(6.903 productos)
- Metabolitos secundarios(14.369 productos)
Se han encontrado 130609 productos de "Compuestos y reactivos bioquímicos"
Human IL1 β ELISA kit
ELISA kit for the detection of IL1 beta in the research laboratory
Pureza:Min. 95%POLR3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3B antibody, catalog no. 70R-2297
Pureza:Min. 95%Goat anti Donkey IgG (H + L) (HRP)
This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.Pureza:Min. 95%RGS16 antibody
RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
LY 2584702
CAS:Inhibitor of ribosomal protein kinase p70S6K
Fórmula:C21H19F4N7Pureza:Min. 95%Peso molecular:445.42 g/molKCNK10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK10 antibody, catalog no. 70R-1532
Pureza:Min. 95%CNPase antibody
The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.
H-FATTFYQHLADSK-OH
Peptide H-FATTFYQHLADSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PIWIL4 antibody
PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
2-Methyl-3-[(2E,6E)-3,7,11-trimethyldodeca-2,6,10-trienyl]-1H-quinolin-4-one
CAS:2-Methyl-3-[(2E,6E)-3,7,11-trimethyldodeca-2,6,10-trienyl]-1H-quinolin-4-one is a ligand that binds to the receptor and activates it. It is also an agonist of the ion channel. The 2-methyl group in this compound is responsible for binding to the receptor and activating it. The 1H quinolin-4one moiety is responsible for binding to the ion channel. This compound has been shown to be a potent inhibitor of protein interactions. The high purity of this compound makes it suitable for use in research tools such as antibody production and recombinant protein production.
Fórmula:C25H33NOPureza:Min. 95%Peso molecular:363.5 g/molRef: 3D-IEA35413
Producto descatalogadoHIV1 tat antibody
HIV1 tat antibody was raised in mouse using HIV-1 tat epitope mapped to N-terminus of HIV -1 tat as the immunogen.CKMB Antibody
The CKMB Antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target creatine kinase, an enzyme that plays a crucial role in energy metabolism. This antibody is used for immobilization purposes and can be utilized in various research applications.DIRAS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DIRAS1 antibody, catalog no. 70R-5821
Pureza:Min. 95%
![2-Methyl-3-[(2E,6E)-3,7,11-trimethyldodeca-2,6,10-trienyl]-1H-quinolin-4-one](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FIEA35413.webp&w=3840&q=75)
