Compuestos y reactivos bioquímicos
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(98.574 productos)
- Por objetivo biológico(100.660 productos)
- Según efectos farmacológicos(6.934 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(362 productos)
- Biología Vegetal(6.908 productos)
- Metabolitos secundarios(14.364 productos)
Se han encontrado 130473 productos de "Compuestos y reactivos bioquímicos"
SAR-020106
CAS:SAR-020106 is a small molecule inhibitor that binds to the cell factor, preventing it from binding to its target on cells. SAR-020106 has been shown to inhibit the growth of solid tumours in vitro and in vivo. The mechanism of action is not known, but may be due to inhibition of thymidylate synthesis or induction of apoptosis. SAR-020106 has minimal toxicity and a low potential for drug resistance, which makes it an attractive candidate for cancer therapy. It also appears to be a potential biomarker for anti-cancer drug discovery programs.
SAR-020106 exhibits pharmacokinetic properties that are suitable for oral administration.Fórmula:C19H19ClN6OPureza:Min. 95%Peso molecular:382.85 g/molRef: 3D-JXB84357
Producto descatalogadoIFITM1 antibody
The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.
IGF2BP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IGF2BP2 antibody, catalog no. 70R-4909
Pureza:Min. 95%SMNDC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMNDC1 antibody, catalog no. 70R-5033
Pureza:Min. 95%CORIN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CORIN antibody, catalog no. 70R-1759
Pureza:Min. 95%TPI1 antibody
TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID
CLUAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLUAP1 antibody, catalog no. 70R-9309
Pureza:Min. 95%IER5L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IER5L antibody, catalog no. 70R-4284
Pureza:Min. 95%GLA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLA antibody, catalog no. 70R-5451
Pureza:Min. 95%KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
C19ORF47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf47 antibody, catalog no. 70R-3346
Pureza:Min. 95%ZNF675 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF675 antibody, catalog no. 70R-9564
Pureza:Min. 95%C16orf71 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf71 antibody, catalog no. 70R-9196
Pureza:Min. 95%RP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RP2 antibody, catalog no. 70R-4335
Pureza:Min. 95%Acd Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Acd antibody, catalog no. 70R-8190
Pureza:Min. 95%SNRPA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPA antibody, catalog no. 70R-4992
Pureza:Min. 95%DLG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DLG3 antibody, catalog no. 70R-6604
Pureza:Min. 95%
