Compuestos y reactivos bioquímicos

CTSL2 antibody was raised in Rabbit using Human CTSL2 as the immunogen

Affinity purified Rabbit polyclonal KPNA4 antibody

SM-16 cells are pluripotent cells that can differentiate into various cell types, including cardiomyocytes, neurons, and adipocytes. They have been shown to be resistant to the effects of fatty acid and insecticide. SM-16 cells are responsive to a variety of stimuli. In particular, they express Toll-like receptors (TLRs) and respond by modulating cytokine expression in response to bacterial strain or lipid exposure. SM-16 cells have also been shown to inhibit tumor growth in mice bearing human leukemia cell lines. SM-16 cells have immunomodulatory effects on both normal human macrophages and on T lymphocyte function.
SM 16 is a mouse cell line that was obtained from a BALB/c mouse embryo at embryonic day 12.5 (E12.5). The cells were grown as adherent cultures in DMEM supplemented with 10% fetal bovine serum, 2 mM L-glutamine, penicillin/streptomycin solution

KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

YKL-05-099 is a small molecule that inhibits the activity of histone acetyltransferases and histone deacetylases. Histones are proteins involved in DNA packaging, which are important for the transcriptional regulation of genes. YKL-05-099 has been shown to inhibit leukemia cells by inhibiting the anabolic effect of all-trans retinoic acid. YKL-05-099 also modulates cellular localization, affecting the migration of hematopoietic cells to bone marrow and their proliferation. The molecule has been shown to have pharmacokinetic properties that allow it to be administered orally. It is currently being studied as a potential treatment for myelodysplastic syndrome, a condition caused by abnormal hematopoietic cells in bone marrow.

alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids  VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

A synthetic peptide for use as a blocking control in assays to test for specificity of BCL7A antibody, catalog no. 70R-3771

Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of GABARAP antibody, catalog no. 70R-2213

Sheep Haptoglobin ELISA Kit;

A synthetic peptide for use as a blocking control in assays to test for specificity of SMNDC1 antibody, catalog no. 70R-5034

A synthetic peptide for use as a blocking control in assays to test for specificity of C5AR1 antibody, catalog no. 70R-9975

A synthetic peptide for use as a blocking control in assays to test for specificity of PIGV antibody, catalog no. 70R-1879

Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.

Rabbit Plasminogen ELISA Kit

RO0270608 is an inhibitor that induces apoptosis in human cells by inhibiting specific kinases. It has been shown to be effective against Chinese hamster ovary (CHO) cells, and also inhibits angiotensin II-induced signaling pathways. RO0270608 has potential as a therapeutic agent for the treatment of tumors, as it has been shown to inhibit the growth of tumor cells in vitro. In addition, RO0270608 is an analog of voriconazole, which has been used as an antifungal drug. The cellulose-based inhibitors have anticancer properties and can be used for the treatment of cancer. RO0270608 may also have potential applications in the diagnosis and treatment of urinary tract infections caused by bacteria resistant to traditional antibiotics.

The Annexin I antibody is a valuable tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be highly effective in a variety of applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of MARVELD3 antibody, catalog no. 70R-6394