Compuestos y reactivos bioquímicos

<p>The CD137L antibody is a powerful tool in the field of life sciences. It has the ability to induce lysis, or cell death, in certain cells. This antibody specifically targets parathyroid hormone-related protein (PTHrP), fibronectin, insulin, E-cadherin, and β-catenin. It is a polyclonal antibody, which means it is derived from multiple sources and can recognize various epitopes on its target proteins.</p>

<p>TNF alpha protein is a neutralizing antibody that targets glial fibrillary acidic proteins in the human body. It is widely used in Life Sciences research and can be conjugated to cellulose for various applications. This monoclonal antibody specifically binds to TNF-α, a cytokine involved in inflammation and immune response. By binding to TNF-α, this antibody inhibits its activity and reduces the inflammatory response. TNF alpha protein has been shown to effectively neutralize TNF-α in human serum, making it a valuable tool for studying the role of this cytokine in various diseases and conditions. Additionally, it has been found to have inhibitory effects on adipose tissue, suggesting potential therapeutic applications in obesity-related disorders. With its high specificity and efficacy, TNF alpha protein is an essential component in research related to inflammatory diseases and immune regulation.</p>

<p>The Myoglobin antibody is a highly specific monoclonal antibody that targets the myoglobin protein. It can be used in various applications, such as immunoassays, protein-protein interaction studies, and as an inhibitor in life science research. This antibody is produced using isolated nucleic acids and has been extensively tested for its specificity and sensitivity. It binds to myoglobin with high affinity, making it an ideal tool for detecting and quantifying myoglobin levels in biological samples. The Myoglobin antibody is conjugated with maleimide, allowing for easy coupling to microspheres or other surfaces for use in various experimental setups. Its immunosuppressant properties make it a valuable tool in understanding the role of myoglobin in different physiological processes. Trust the Myoglobin antibody for accurate and reliable results in your research endeavors.</p>

<p>Purified Polyclonal FOXC1/2 antibody</p>

<p>The IGJ antibody is a monoclonal antibody that specifically targets insulin in the human body. It is designed to bind to insulin molecules and prevent their interaction with insulin receptors, thereby inhibiting their activity. This antibody is commonly used in Life Sciences research to study the role of insulin in various physiological processes.</p>

<p>The Septin 9 antibody is a highly specialized monoclonal antibody that targets a specific cell antigen. It has been extensively studied in the field of pluripotent stem cells and has shown promising results in various applications. This antibody has been used in research studies involving the treatment of cancer with doxorubicin, as well as in polymerase chain reactions (PCR) to detect specific messenger RNA molecules.</p>

<p>Rabbit polyclonal WDR4 antibody</p>

<p>Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.</p>

<p>KCNJ16 antibody was raised using the middle region of KCNJ16 corresponding to a region with amino acids RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL</p>

<p>PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL</p>

<p>Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.</p>

<p>Rabbit Polyclonal MSK1 antibody (Thr581)</p>

<p>The PEX5 antibody is a monoclonal antibody that targets fibronectin, a growth factor involved in various cellular processes. This antibody specifically binds to PEX5, a protein involved in peroxisome biogenesis and function. It has been shown to inhibit endothelial cell growth and proliferation, making it a potential therapeutic option for diseases characterized by abnormal blood vessel formation. Additionally, the PEX5 antibody has demonstrated efficacy as a multidrug combination therapy when used in conjunction with other targeted therapies, such as epidermal growth factor inhibitors or anti-HER2 antibodies like trastuzumab. Its ability to modulate signaling pathways involving β-catenin and VEGF-C further highlights its potential applications in life sciences research. With its high specificity and affinity for its target, the PEX5 antibody offers valuable insights into peroxisome biology and holds promise for future therapeutic interventions.</p>

<p>RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS</p>

<p>Bedaquiline is a medicinal compound that acts as an inhibitor of protein kinases. It has been used as an anticancer agent due to its ability to inhibit the growth and proliferation of cancer cells. Bedaquiline works by binding to the ATP-binding site of kinases, thereby inhibiting their activity and leading to apoptosis in cancer cells. This compound has shown promise in treating Chinese hamster ovary (CHO) cells, which are commonly used in research for cancer therapies. Additionally, Bedaquiline has been found to be effective against urinary tract infections caused by certain bacteria by targeting the bacterial ATP synthase enzyme. This analog is a potent inhibitor of tumor growth and may have potential for the treatment of various types of cancers.</p>

<p>CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen</p>

<p>CD127 antibody is a polyclonal antibody that targets the TGF-beta protein. It is commonly used in life sciences research to study collagen and other related proteins. This antibody can be used in various applications, such as polymerase chain reaction (PCR), hybridization, and cytotoxic assays. CD127 antibody specifically binds to TGF-beta1 and can be used to detect its presence in samples. Additionally, this antibody has been shown to have an inhibitory effect on lectins, which are glycan-binding proteins. CD127 antibody is also known to promote the growth of human hepatocytes and exhibit natriuretic properties. Overall, this versatile antibody is a valuable tool for researchers studying TGF-beta signaling pathways and related biological processes.</p>

<p>Rabbit polyclonal SGCG antibody</p>

<p>The HIV1 gp41 protein is a key component of the human immunodeficiency virus (HIV-1) and plays a crucial role in viral entry into host cells. It is targeted by trastuzumab, an antibody used in the treatment of certain types of cancer. The protein interacts with cell surface receptors and co-receptors to mediate fusion between the viral envelope and the host cell membrane.</p>

<p>Mouse monoclonal CST2 antibody</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>AU1 tag antibody was raised in rabbit using AU1 (DTYRYI) conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal HAGHL antibody</p>

<p>The CD69 antibody is a monoclonal antibody that specifically targets the CD69 antigen. CD69 is a cell surface protein that is expressed on activated immune cells, such as T cells and natural killer cells. This antibody can be used in various research applications in the field of Life Sciences to study immune cell activation and function. It has been shown to inhibit hemolysis caused by mycoplasma genitalium infection and can be used as an inhibitor in related studies. The CD69 antibody is also used for the production of human monoclonal antibodies, which are important tools for studying hormone peptides, steroids, and other molecules involved in immune responses. Its unique ability to bind to CD69 dimers makes it a valuable tool for detecting autoantibodies or studying adipose tissue biology.</p>

<p>Purified Polyclonal ATF7 antibody</p>

<p>Halofuginone 5 Conjugate for use in immunoassays</p>

<p>LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS</p>

<p>CD56 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CD56 antigen, which is expressed on various cell types, including natural killer cells and neural tissues. This antibody is commonly used in studies involving growth factors such as GM-CSF and TGF-β1, as well as colony-stimulating factors. CD56 antibody has been shown to have high affinity and specificity for its target antigen, making it a valuable tool for detecting and analyzing CD56-expressing cells in samples such as human serum or tissue sections. Its binding mechanism involves disulfide bonds, ensuring stable and reliable results. Additionally, this antibody can be utilized in techniques such as immunohistochemistry or flow cytometry to investigate the role of CD56 in various biological processes.</p>

<p>ZNF524 antibody was raised in rabbit using the N terminal of ZNF524 as the immunogen</p>

<p>Rabbit polyclonal UBD antibody</p>

<p>Wdr8 antibody was raised in rabbit using the N terminal of Wdr8 as the immunogen</p>

<p>Rabbit polyclonal TSC22D3 antibody</p>

<p>The West Nile virus antibody is a monoclonal antibody used in Life Sciences. It binds to specific proteins and inhibits the growth factor GM-CSF, which is involved in the production of white blood cells. This antibody can be used as a research tool for studying the effects of GM-CSF inhibitors on cell growth and differentiation. Additionally, it has been shown to interact with other antibodies, such as transferrin and actin filaments, further expanding its potential applications in various experimental settings. With its ability to modulate colony-stimulating factors and impact cell function, this antibody offers promising opportunities for scientific advancements in the field of immunology and beyond.</p>

<p>Rabbit polyclonal ABCA6 antibody</p>

<p>Mouse monoclonal GRHPR antibody</p>

<p>The SPO11 antibody is a highly specialized protein that plays a crucial role in the process of DNA recombination during meiosis. It specifically targets and binds to the SPO11 protein, which is responsible for initiating the formation of double-strand breaks in DNA. This antibody has been extensively studied in the field of life sciences and is widely used as a research tool in various applications.</p>

<p>Purified recombinant CXCL17 protein (His tag)</p>

<p>Purified recombinant PLA1A protein (His tag)</p>

<p>POLE4 antibody was raised in rabbit using the N terminal of POLE4 as the immunogen</p>

<p>MUC1 antibody was raised in mouse using purified native MUC1 as the immunogen.</p>

<p>The MIOX antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets alpha-fetoprotein, an important antigen involved in various biological processes. This antibody is highly specific and has been extensively validated for its accuracy and reliability.</p>

<p>Mouse monoclonal SERPINE2 antibody</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC</p>

<p>ASXL1 antibody was raised in mouse using recombinant Human Additional Sex Combs Like 1 (Drosophila) (Asxl1)</p>

<p>Purified recombinant POLR1C protein (His tag)</p>

<p>LRRC8C antibody was raised in Rabbit using Human LRRC8C as the immunogen</p>

<p>Matrilin 3 antibody was raised using the N terminal of MATN3 corresponding to a region with amino acids ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADT</p>

<p>GPKOW antibody was raised in Rabbit using Human GPKOW as the immunogen</p>

<p>MRPL38 antibody was raised in Rabbit using Human MRPL38 as the immunogen</p>