Anticuerpos primarios

The SERCA1 antibody is an active agent that is commonly used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to SERCA1, a low-density protein found in various cells including MCF-7 cells. This antibody is often used in research studies to investigate the role of SERCA1 in different cellular processes.

The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.

LPIN2 antibody was raised in rabbit using the C terminal of LPIN2 as the immunogen

CD46 antibody was raised in Rabbit using Human CD46 as the immunogen

CD49b antibody (Allophycocyanin-CY7) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.

HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen

Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(c) fragment as the immunogen.

The MTHFR antibody is a glycosylated glycopeptide that belongs to the class of chemokines. It is used in the field of Life Sciences for various applications, including the detection and quantification of interferon-gamma (IFN-γ) in biological samples. This antibody specifically targets the nuclear protein MTHFR and can be used in experiments such as immunofluorescence and Western blotting. Additionally, it has been shown to have inhibitory effects on factors such as alpha-fetoprotein and β-catenin, making it a valuable tool for studying signal transduction pathways. With its high specificity and affinity, the MTHFR antibody is an essential component for researchers working in the field of molecular biology and cellular signaling.

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

Affinity purified Mouse polyclonal Connexin 32 antibody

Goat anti-mouse IgM (Fab'2) was raised in goat using murine IgM mu heavy chain as the immunogen.

The RB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the histidine receptor, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in blocking the actions of histidine, thereby modulating its effects on cellular signaling pathways.

EGLN2 antibody was raised in Rabbit using Human EGLN2 as the immunogen

COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

The Flag Tag antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is designed to specifically target and bind to the Flag epitope, which is a small peptide sequence commonly added to proteins for detection and purification purposes. This antibody has been extensively validated for use in various applications such as immunoassays, Western blotting, immunofluorescence, and flow cytometry. One of the key advantages of the Flag Tag antibody is its high affinity and specificity towards the Flag epitope. This ensures reliable and accurate detection of proteins carrying this tag. Additionally, the antibody exhibits minimal cross-reactivity with other commonly used tags, making it an ideal choice for researchers working with multiple protein expression systems. In addition to its exceptional performance in protein detection, the Flag Tag antibody also offers excellent stability and reproducibility. It can withstand harsh experimental conditions such as high temperatures or denaturing agents without compromising its binding efficiency. This makes it suitable for a wide range

Mouse monoclonal Morphine 3 antibody

Rabbit polyclonal NRBP2 antibody

The CD90 antibody is a highly specific polyclonal antibody that targets the CD90 antigen, also known as Thy-1. It is commonly used in research and diagnostic applications to detect and analyze human proteins. This antibody has been extensively validated for its high affinity and specificity in various assays, including immunohistochemistry, flow cytometry, and western blotting.

Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.

KLHL18 antibody was raised in Rabbit using Human KLHL18 as the immunogen