Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.722 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.591 productos)
- Anticuerpos del metabolismo(291 productos)
- Anticuerpos de microbiología(741 productos)
- Transducción de señales(2.771 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75602 productos de "Anticuerpos primarios"
PAPPA antibody
PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.Caspase 1 antibody
Caspase 1 antibody is a highly specific antibody that targets caspase 1, an enzyme involved in the inflammatory response. This antibody has been extensively tested and validated using human serum samples. It has been shown to effectively detect and quantify caspase 1 levels in various biological samples.
CCR4 antibody
The CCR4 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize neurotrophic factors in the body. It specifically targets and inhibits the activity of TGF-β1, a key factor involved in cholinergic signaling. This antibody binds to specific receptor molecules on cells, preventing the activation of downstream signaling pathways and ultimately leading to a reduction in neurotrophic factor activity.
AKR1B10 antibody
AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
MCP2 antibody
MCP2 antibody was raised in mouse using highly pure recombinant human MCP-2 as the immunogen.
AMACR antibody
AMACR antibody was raised in Mouse using a purified recombinant fragment of human AMACR expressed in E. coli as the immunogen.EGFL8 antibody
EGFL8 antibody was raised using the C terminal of EGFL8 corresponding to a region with amino acids QAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS
GAD67 antibody
The GAD67 antibody is a highly reactive monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the 3-kinase domain of glutamate decarboxylase 67 (GAD67), an enzyme involved in the synthesis of the neurotransmitter gamma-aminobutyric acid (GABA). This antibody has been extensively validated for various applications, including immunohistochemistry, immunofluorescence, and Western blotting.
CFTR antibody
CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.
