Anticuerpos primarios

Rabbit polyclonal WIPF2 antibody

The COL1A2 antibody is a powerful tool in Life Sciences research. This antibody has inhibitory properties and can be used in various applications such as insulin immunoassays and the study of liver microsomes. It belongs to the class of Polyclonal Antibodies, which are highly specific and versatile. The COL1A2 antibody can be used to detect and quantify interferon, TGF-β1, and other autoantibodies in samples. It specifically targets nuclear tyrosine residues that are activated during cellular processes. Researchers rely on this monoclonal antibody for its exceptional sensitivity and reliability in their experiments.

Armenian Hamster monoclonal PD1 antibody (PE)

The DNASE1L3 antibody is a monoclonal antibody that specifically targets DNASE1L3, an enzyme involved in the degradation of DNA. This antibody has high affinity and specificity for DNASE1L3 and can be used as a diagnostic reagent in various research and clinical settings.

Affinity purified Rabbit polyclonal ITGA1 antibody

The CDK4 antibody is a cytotoxic monoclonal antibody that targets the cyclin-dependent kinase 4 (CDK4) protein. It is used in the field of Life Sciences for various applications, including research and diagnostics. The CDK4 antibody specifically binds to CDK4 and inhibits its activity, which plays a crucial role in cell cycle regulation. This inhibition can lead to cell cycle arrest and apoptosis in cancer cells that rely on CDK4 for uncontrolled growth. Additionally, the CDK4 antibody has been shown to modulate other signaling pathways, such as the E-cadherin/β-catenin pathway, which is involved in cell adhesion and migration. This antibody can be used in combination with other antibodies or drugs to enhance its efficacy against specific targets or diseases. Its potential applications extend beyond cancer treatment, as it has also shown antiviral activity against certain viruses and interferon-inducing properties. Researchers and scientists rely on the CDK4 antibody to

TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen

GMDS antibody was raised in Rabbit using Human GMDS as the immunogen

The MMP8 antibody is a polyclonal antibody that specifically targets matrix metalloproteinase 8 (MMP8). It is commonly used in research and diagnostic applications to detect and quantify the presence of MMP8 in various samples.

A2M antibody was raised in Rabbit using Human A2M as the immunogen

DGUOK antibody was raised in Rabbit using Human DGUOK as the immunogen

APBA3 antibody was raised in rabbit using the N terminal of APBA3 as the immunogen

Affinity purified Rabbit polyclonal alpha Tubulin 1A antibody

The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.