Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(741 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75562 productos de "Anticuerpos primarios"
MIP4 antibody
MIP4 antibody was raised in rabbit using highly pure recombinant hMIP-4 as the immunogen.
NANP antibody
The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein (CSP) found on the surface of Plasmodium falciparum, the parasite responsible for malaria. This antibody has been shown to inhibit the invasion of red blood cells by the parasite and disrupt its life cycle. It binds to CSP and prevents it from interacting with host cell receptors, thereby preventing infection. The NANP antibody also has potential therapeutic applications in the treatment of other diseases, as it has been found to bind to other proteins such as collagen and tyrosine kinase-like growth factor-2. Its unique properties make it a valuable tool in life sciences research and drug development.
LOC400856 antibody
LOC400856 antibody was raised using the C terminal of LOC400856 corresponding to a region with amino acids SLHTSPRAEGAGSGLSQPQRRALTAQGGAEGLLERGQSGHGGRGGAKSER
Osteopontin antibody
The Osteopontin antibody is a highly effective monoclonal antibody that targets the protein osteopontin. It is specifically designed to bind to this protein and inhibit its activity. Osteopontin is involved in various biological processes, including cell adhesion, migration, and inflammation. By targeting osteopontin, this antibody can potentially have therapeutic applications in various diseases, including cancer and autoimmune disorders.Chloramphenicol antibody
The Chloramphenicol antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to chloramphenicol, a medicament commonly used as an anticoagulant in medical treatments. This antibody is capable of recognizing and binding to the molecule drug with high affinity and specificity.Pureza:Min. 95%EPHA3 antibody
The EPHA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the fatty acid receptor EPHA3, which plays a crucial role in various cellular processes such as cell growth and differentiation. This antibody has been extensively studied and validated for its ability to specifically bind to EPHA3, making it an essential tool for researchers working in this area.
FGF23 antibody
FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.
ZNF780B antibody
ZNF780B antibody was raised in rabbit using the N terminal of ZNF780B as the immunogen
Pureza:Min. 95%HTRA4 antibody
HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDPureza:Min. 95%CDC45L antibody
The CDC45L antibody is a highly specialized monoclonal antibody that targets the CDC45L protein. This protein plays an important role in various biological processes, including DNA replication and cell cycle regulation. By specifically binding to CDC45L, this antibody can effectively inhibit its function and disrupt these processes.
