Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(741 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75562 productos de "Anticuerpos primarios"
Benzodiazepine antibody
Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.
Caspase 7 antibody
The Caspase 7 antibody is a powerful inhibitory factor used in Life Sciences research. This polyclonal antibody specifically targets the protein caspase 7, which plays a crucial role in programmed cell death (apoptosis). By blocking the activity of caspase 7, this antibody allows researchers to investigate its function and explore its potential as a therapeutic target.
FAM62B antibody
FAM62B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Pureza:Min. 95%SQSTM1 antibody
The SQSTM1 antibody is a highly specialized monoclonal antibody that is used for immobilization and detection of SQSTM1 protein. It specifically targets and binds to the SQSTM1 protein, allowing for its easy detection and analysis in various biological samples. This antibody is widely used in research laboratories and diagnostic settings to study the role of SQSTM1 in different cellular processes.
CD23 antibody
CD23 antibody was raised in mouse using human peripheral myeloma cells as the immunogen.
Rat RBC antibody
Rat RBC antibody was raised in rabbit using rat erythrocytes as the immunogen.Pureza:Min. 95%LLO antibody
The LLO antibody is a high-quality monoclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize superoxide, a highly reactive oxygen species that can cause damage to cells and tissues. This antibody has a high specific activity and exhibits low density, making it an ideal choice for various applications such as enzyme-linked immunosorbent assays (ELISA), Western blotting, and immunohistochemistry.
