Anticuerpos primarios

Rabbit polyclonal RPL5 antibody

CD40LG antibody was raised in Rabbit using Human CD40LG as the immunogen

The BIM antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is known for its cytotoxic properties. This colloidal antibody specifically targets epidermal growth factor (EGF) and acts as a neutralizing agent against it. It is also effective against other growth factors such as TGF-beta. The BIM antibody comes in both polyclonal and monoclonal forms, providing options for different research needs. In addition to its role in inhibiting the activity of EGF-like molecules, this antibody has shown potential in targeting chemokines and endothelial growth factors. The BIM antibody is carefully formulated with buffer solutions to ensure stability and optimal performance. It can be used in various research applications within the Life Sciences field, making it an essential tool for scientists and researchers alike.

The PGCP antibody is a synthetic polyclonal antibody that specifically targets glutamate. It can be used in Life Sciences research for various applications, including staining and detection of glutamate in cells and tissues. The antibody solution contains streptavidin-conjugated alkaline phosphatase, which allows for chromogenic or fluorescent detection methods. The PGCP antibody has high affinity and specificity towards glutamate, making it a valuable tool for studying the role of this neurotransmitter in biological processes. Its conjugation to alkaline phosphatase enables easy visualization and quantification of glutamate levels in samples using chromogenic or fluorescent molecules.

IL17A antibody is a monoclonal antibody that specifically targets and inhibits the activity of IL-17A, a cytokine involved in immune responses and inflammation. IL-17A plays a crucial role in various autoimmune diseases and inflammatory conditions. The IL17A antibody binds to IL-17A receptors, preventing the interaction between IL-17A and its receptors. This inhibition leads to a reduction in the production of pro-inflammatory molecules and cytokines, thereby suppressing the immune response. The IL17A antibody is widely used in immunoassays to detect and quantify IL-17A levels in biological samples. It is also utilized in research studies to investigate the role of IL-17A in different diseases and as a potential therapeutic target for treating inflammatory disorders. With its high specificity and potency, the IL17A antibody provides researchers with valuable tools for understanding the complex mechanisms underlying immune system dysregulation.

HLA-DQA2 antibody was raised using the N terminal of HLA-DQA2 corresponding to a region with amino acids GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS

The PTGES3 antibody is a highly specialized product used in the field of Life Sciences. It is an isolated nucleic acid that specifically targets the PTGES3 gene, which encodes for the enzyme prostaglandin E synthase 3. This enzyme plays a crucial role in the synthesis of prostaglandins, which are important signaling molecules involved in various physiological processes such as inflammation and pain.

NKRF antibody was raised in Rabbit using Human NKRF as the immunogen

The MCD antibody is a powerful tool used in Life Sciences research for various applications. It is commonly used in transcription-polymerase chain reaction (PCR) experiments to detect and amplify specific DNA sequences. The MCD antibody specifically targets terminal deoxynucleotidyl transferase, an enzyme involved in DNA synthesis and repair. By binding to this enzyme, the MCD antibody allows researchers to study its role in different biological processes.

NFE2L1 antibody was raised in Rabbit using Human NFE2L1 as the immunogen

TCHP antibody was raised in rabbit using the C terminal of TCHP as the immunogen

Affinity purified Rabbit polyclonal SPFH2 antibody

LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

FAF1 antibody was raised in Rabbit using Human FAF1 as the immunogen

FBP1 antibody was raised in Rabbit using Human FBP1 as the immunogen

KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

Affinity purified Rabbit polyclonal AHI1 antibody

The GILT antibody is a cytotoxic monoclonal antibody that specifically targets amyloid plaque protein dimers. It is widely used in Life Sciences research to study the formation and accumulation of amyloid plaques, which are associated with various neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has high specificity and affinity for amyloid plaque protein dimers, making it an excellent tool for detecting and quantifying these abnormal protein aggregates. Additionally, the GILT antibody has been shown to have inhibitory effects on the growth factor signaling pathway, making it a potential therapeutic candidate for diseases characterized by excessive cell proliferation. With its exceptional quality and reliability, this antibody is a valuable asset for researchers investigating amyloid-related disorders.