Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(741 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75562 productos de "Anticuerpos primarios"
Goat anti Human IgG (H + L) (HRP)
Goat anti-human IgG (H + L) (HRP) was raised in goat using hamster IgG (H & L) as the immunogen.
CTNNB1 antibody
The CTNNB1 antibody is a monoclonal antibody that specifically targets the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, signal transduction, and gene expression. The CTNNB1 antibody has been extensively studied and shown to be highly specific and sensitive in detecting CTNNB1 in various biological samples.
IL11 antibody (HRP)
IL11 antibody was raised in Mouse using recombinant human IL-11 as the immunogen.AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
WARS2 antibody
WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
SLC25A16 antibody
SLC25A16 antibody was raised using the N terminal of SLC25A16 corresponding to a region with amino acids KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM
