Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75512 productos de "Anticuerpos primarios"
PARK7 antibody
The PARK7 antibody is a monoclonal antibody that targets the PARK7 protein, also known as DJ-1. This protein is involved in various cellular processes, including hepatocyte growth, fibronectin binding, and lipoprotein lipase activity. The PARK7 antibody has been shown to inhibit the growth of MCF-7 cells, a breast cancer cell line. Additionally, it has cytotoxic effects on tumor cells and can enhance the effectiveness of retinoid-based therapies. The PARK7 antibody is also useful for detecting the presence of creatine kinase and multidrug resistance-associated protein 1 (MRP1). It is available as both polyclonal and monoclonal antibodies.
COL8A2 antibody
COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen
Pureza:Min. 95%PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
Giardia lamblia antibody
The Giardia lamblia antibody is a highly specialized product used in Life Sciences research. This antibody specifically targets the circumsporozoite protein found in Giardia lamblia, an intestinal parasite that causes giardiasis. The antibody is designed to bind to this protein and neutralize its activity.
Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.
Goat anti Rat IgM (HRP)
Goat anti-rat IgM (HRP) was raised in goat using rat IgM mu chain as the immunogen.Pureza:Min. 95%CAD antibody
CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE
Cathepsin D antibody
The Cathepsin D antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets Cathepsin D, an enzyme involved in various cellular processes. The antibody is colloidal in nature, allowing for easy and efficient binding to its target. It has been extensively tested and validated for use in research applications such as immunohistochemistry, Western blotting, and ELISA.GJA9 antibody
GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
Pureza:Min. 95%SP1 antibody
The SP1 antibody is a glycoprotein inhibitor that is pegylated and classified as a monoclonal antibody. It is commonly used in Life Sciences research and has various applications. The SP1 antibody has been found to be effective in neutralizing the activity of trastuzumab, an antibody used in the treatment of breast cancer. Additionally, it has shown potential as a therapeutic agent for targeting specific growth factors, such as glucagon and fatty acid receptors. This antibody exhibits cytotoxic properties and can inhibit the growth of cancer cells by blocking essential cellular processes. Furthermore, the SP1 antibody has been utilized in studies involving glutamate receptors and has proven to be valuable in understanding their functions. Overall, this highly specialized antibody offers great potential for researchers seeking to investigate various biological pathways and targets within the human body.
Pureza:Min. 95%JMJD5 antibody
JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen
Pureza:Min. 95%
