Anticuerpos primarios

GP1BA antibody was raised in Rabbit using Human GP1BA as the immunogen

FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG

WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN

The IGJ antibody is a monoclonal antibody that specifically targets insulins. It is cytotoxic and works by binding to insulin molecules, rendering them inactive. This colloidal antibody has neutralizing properties, meaning it can effectively counteract the effects of autoantibodies that may be present in the body. The IGJ antibody is designed to target specific amino acid residues on insulin, ensuring precise and effective binding. It has been extensively tested in Life Sciences research and has shown high affinity for insulin in human serum samples. With its histidine-rich structure, this monoclonal antibody offers a reliable tool for studying insulin-related processes and mechanisms.

IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.

GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ

MEPE antibody was raised in Rabbit using Human MEPE as the immunogen

Rabbit polyclonal SDSL antibody

FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA

Rabbit polyclonal SRM antibody

Mouse monoclonal SULT1C2 antibody

The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.

The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.

The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.

GOT2 antibody was raised in Rabbit using Human GOT2 as the immunogen