Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75512 productos de "Anticuerpos primarios"
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody that targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) protein. This cysteine-rich protein plays a crucial role in various cellular processes, including glycolysis and energy metabolism. Additionally, GAPDH has been identified as an angiogenic inducer and an activated growth factor.
ABL2 antibody
ABL2 antibody was raised in Mouse using a purified recombinant fragment of ABL2 expressed in E. coli as the immunogen.
Hepatitis B Virus antibody
Hepatitis B virus antibody was raised in mouse using hepatitis B virus as the immunogen.ALPPL2 antibody
The ALPPL2 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets ALPPL2, which is an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting ALPPL2 expression in different tissues and cell types.
IL13 antibody
The IL13 antibody is a monoclonal antibody that specifically targets IL-13, a cytokine involved in various immune responses and inflammatory processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in fluorescence-activated cell sorting (FACS) experiments. It has a molecular weight suitable for complex formation and can effectively inhibit the activity of IL-13.
FGF23 antibody
FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.
LYRM1 antibody
LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP
GLIS3 antibody
GLIS3 antibody was raised in rabbit using the N terminal of GLIS3 as the immunogenPureza:Min. 95%
