Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75512 productos de "Anticuerpos primarios"
VAV1 antibody
The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.
RHAG antibody
RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
TRSPAP1 antibody
TRSPAP1 antibody was raised using the middle region of TRSPAP1 corresponding to a region with amino acids KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
CD147 antibody
The CD147 antibody is a versatile and potent steroid that has antidiabetic properties. It acts by inhibiting the activity of phosphatase, which plays a crucial role in regulating blood glucose levels. Additionally, this antibody can modulate chemokine activity, making it an effective tool for studying immune responses.
LBP antibody
The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.
GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Pureza:Min. 95%ASB6 antibody
ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVPureza:Min. 95%ACTR1A antibody
ACTR1A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
SGLT1 antibody
SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.Pureza:Min. 95%
