Anticuerpos primarios

ANXA8L2 antibody was raised in Rabbit using Human ANXA8L2 as the immunogen

The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.

Mouse monoclonal ZIM2 antibody

Rabbit polyclonal Glycogen Synthase antibody (Ser645)

GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Mouse monoclonal CD1d antibody (PE)

The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.

Rabbit polyclonal VPS45 antibody

Calibrator for Cat ELISA Kit

Mouse monoclonal Cytokeratin 5 + 8 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.

CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

Affinity purified Goat anti Human IgG antibody

Purified Polyclonal NCKX1 antibody

RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.

The p53 antibody is a highly specialized cytotoxic antibody that plays a crucial role in regulating cell growth and preventing tumor formation. It is known for its ability to target and neutralize antiphospholipid antibodies, which can lead to autoimmune disorders. Additionally, the p53 antibody has been shown to inhibit the activity of tyrosinase, an enzyme involved in melanin production, making it a potential treatment option for hyperpigmentation disorders.

MLLT4 antibody was raised in Rabbit using Human MLLT4 as the immunogen