Anticuerpos primarios

DNAL1 antibody was raised in Rabbit using Human DNAL1 as the immunogen

NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

The TRIM33 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to TRIM33 protein, which plays a crucial role in cellular processes. The antibody is made using advanced techniques and high-quality materials to ensure its effectiveness.

IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen

Rabbit polyclonal QARS antibody

The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.

PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD

CDK3 antibody was raised in rabbit using the C terminal of CDK3 as the immunogen

Mouse monoclonal EPSP synthase antibody

Affinity purified Rabbit polyclonal OFD1 antibody

Rabbit polyclonal CKX2 antibody

RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.

Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.

KIF2B antibody was raised in Rabbit using Human KIF2B as the immunogen