Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.620 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(751 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.793 productos)
- Anticuerpos del metabolismo(279 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.717 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 75326 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PEF1 antibody
<p>PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY</p>Caspase 1 antibody
<p>The Caspase 1 antibody is a highly reactive monoclonal antibody that specifically targets caspase 1, an enzyme involved in inflammatory responses and programmed cell death. This antibody is widely used in life sciences research to study the role of caspase 1 in various biological processes, including adipose tissue inflammation, cancer development, and immune response modulation.</p>TRPC4 antibody
<p>TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL</p>RB1 antibody
<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>EXOSC7 antibody
<p>EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC</p>Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Pureza:Min. 95%Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>NCOR1 antibody
<p>NCOR1 antibody was raised in rabbit using the N terminal of NCOR1 as the immunogen</p>Pureza:Min. 95%MMP23B antibody
<p>MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP</p>Pureza:Min. 95%TBK1 antibody
<p>TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM</p>Pureza:Min. 95%ZGPAT antibody
<p>ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS</p>SPINK6 antibody
<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>Pureza:Min. 95%Toll-like receptor 4 antibody (allophycocyanin)
<p>Rat monoclonal Toll-like receptor 4 antibody (allophycocyanin)</p>
