Anticuerpos primarios

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>Rabbit Polyclonal OR10H4 antibody</p>

<p>Rabbit polyclonal ELMOD2 antibody</p>

<p>Rabbit polyclonal OSR1 antibody (Thr185)</p>

<p>Purified Rabbit polyclonal KCTD18 antibody</p>

<p>HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ</p>

<p>Purified Polyclonal Caspase 14 p10 antibody</p>

<p>The p70S6k antibody is an acidic monoclonal antibody that specifically targets the cysteine disulfide region of the p70S6k protein. It has been widely used in Life Sciences research to study the role of p70S6k in various cellular processes. This antibody has neutralizing activity against oncostatin and natriuretic factors, making it a valuable tool for investigating their signaling pathways. Additionally, the p70S6k antibody has been used as a blood biomarker for ultrasensitive detection of leukemia inhibitory factor in human serum samples. With its high affinity and specificity, this monoclonal antibody is an essential tool for researchers studying the primary amino acid sequence and structure of p70S6k using techniques such as electrode-based assays.</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>Rabbit polyclonal OR4A4 antibody</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>Donkey anti-rat IgG (H + L) (rhodamine) was raised in donkey using Rat IgG (H&amp;L) as the immunogen.</p>

<p>Lp (a) antibody was raised in rabbit using the middle region of LPA as the immunogen</p>

<p>Mouse monoclonal JEV ED3 antibody</p>

<p>Rabbit polyclonal ZNF541 antibody</p>

<p>The POT1 antibody is a growth factor that belongs to the class of Polyclonal Antibodies. It forms dimers with calmodulin and has cytotoxic properties. This antibody is widely used in Life Sciences research, particularly in studies related to epidermal growth factor. It can be used as a monoclonal antibody or in combination with other antibodies. The POT1 antibody has neutralizing effects on human serum and has been shown to inhibit the activity of electrode and gm-csf colony-stimulating factor. Furthermore, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases associated with autoantibodies.</p>

<p>IL21 antibody was raised in rabbit using highly pure recombinant murine IL-21 as the immunogen.</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>Rabbit polyclonal AKAP8 antibody</p>

<p>The Caspase 2 antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to target and detect caspase 2, an enzyme involved in cell apoptosis. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various cellular processes.</p>