Anticuerpos primarios

Mouse monoclonal anti human CREG1 antibody

Rabbit polyclonal HOXC6 antibody

FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Mouse monoclonal ZIM2 antibody

Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.

Rabbit polyclonal UQCRFS1 antibody

The TAF1 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes the endonuclease activity of TAF1, an enzyme involved in various cellular processes such as carbonic and glutamate metabolism, growth factor signaling, and histidine biosynthesis. This monoclonal antibody has been extensively tested and proven to effectively inhibit TAF1's hyaluronidase activity, which is crucial for tissue remodeling and cell migration. Additionally, it has been shown to reduce microvessel density in tumor models, making it a potential therapeutic option for angiogenesis-related disorders. With its high specificity and affinity, the TAF1 antibody is an invaluable asset for researchers in need of reliable tools to study TAF1 function and its implications in various biological processes.

Purified Polyclonal PDE4B/C/D antibody

RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM

The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.

The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.

CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

INTS5 antibody was raised in Rabbit using Human INTS5 as the immunogen

HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.

Rabbit polyclonal PFKFB2 antibody

Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.