Anticuerpos primarios

INS antibody was raised in Rabbit using Human INS as the immunogen

TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.

Affinity purified Rabbit polyclonal RBMY1A1 antibody

The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.

Affinity purified Rabbit polyclonal SUCLA2 antibody

Rabbit polyclonal AKAP2 antibody

SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.

Rabbit polyclonal CKMT antibody (FITC)

The MHC Class I antibody is a potent mitogen that belongs to the group of monoclonal antibodies. It has been extensively studied in the field of Life Sciences for its cytotoxic and growth factor properties. This antibody specifically targets and activates MHC Class I molecules, which are essential for immune recognition and response. Additionally, it has been shown to play a role in collagen immobilization and neutralizing oncolytic adenovirus. With its ability to modulate dopamine and mitogen-activated protein signaling pathways, the MHC Class I antibody is a valuable tool for research in various areas of biology and medicine.

Rabbit polyclonal ARRC antibody

The Actin antibody is a highly specialized monoclonal antibody that targets actin, a key protein involved in various cellular processes. This antibody has been extensively studied and proven to have neutralizing properties against interferon and fatty acid-induced cytotoxicity. It is widely used in Life Sciences research, particularly in studies related to actin filaments and their role in cell structure and function.

The Anti-HIV p24 antibody is a powerful tool in the fight against HIV. This monoclonal antibody specifically targets the p24 protein, which is an essential component of the HIV virus. By binding to this protein, the antibody prevents the virus from replicating and spreading throughout the body. In addition to its antiviral properties, the Anti-HIV p24 antibody has been shown to have other beneficial effects. It has been found to inhibit epidermal growth factor signaling, which is involved in cell proliferation and survival. This can help prevent the spread of cancer cells and may have potential applications in cancer treatment. Furthermore, studies have shown that this antibody can enhance the effectiveness of other targeted therapies, such as trastuzumab for HER2-positive breast cancer. By combining these treatments, researchers have observed improved outcomes and increased patient survival rates. The Anti-HIV p24 antibody also has potential diagnostic applications. It can be used in laboratory tests to detect the presence of HIV infection by binding

The ADAM10 antibody is a highly specialized cytotoxic antibody that targets the tyrosine protease ADAM10. It is widely used in Life Sciences research, particularly in immunohistochemistry studies. This polyclonal antibody has been shown to inhibit the activity of ADAM10, which plays a crucial role in various cellular processes such as interleukin-6 and insulin signaling. The ADAM10 antibody is commonly used as a tool to study the function of this protein and its involvement in disease pathways. Researchers also use monoclonal antibodies against ADAM10 for specific applications, such as insulin or interleukin detection. Additionally, this antibody has potential therapeutic applications due to its ability to modulate ADAM10 activity and downstream effects on cellular processes. Its specificity and high affinity make it an essential tool for studying the biology of ADAM10 and its associated pathways.

Affinity purified Rabbit polyclonal PLA2G3 antibody

CALML3 antibody was raised in rabbit using the middle region of CALML3 as the immunogen

Rabbit polyclonal OR2L5 antibody

Affinity purified Rabbit polyclonal DCAMKL2 antibody

ANXA5 antibody was raised in Rabbit using Human ANXA5 as the immunogen