Anticuerpos primarios

The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.

LMBR1L antibody was raised in Rabbit using Human LMBR1L as the immunogen

DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

Affinity purified Rabbit polyclonal XPR1 antibody

The PLXDC1 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been extensively studied for its role in endothelial growth and angiogenesis. This antibody specifically targets PLXDC1, a receptor that plays a crucial role in regulating the growth and development of blood vessels.

The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.

Rabbit polyclonal FUCA2 antibody

Goat polyclonal Human Ceruloplasmin antibody

SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL

AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.

CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen

FOXE3 antibody was raised in Rabbit using Human FOXE3 as the immunogen

Rabbit polyclonal NR2C1 antibody

The ALPK1 antibody is a highly specific monoclonal antibody that targets the ALPK1 protein. This protein plays a crucial role in various cellular processes, including oncostatin signaling and β-catenin activation. The ALPK1 antibody has been extensively tested and validated for its specificity, ensuring accurate and reliable results in experiments.

Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen

LPCAT2 antibody was raised in Rabbit using Human LPCAT2 as the immunogen