Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(741 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75562 productos de "Anticuerpos primarios"
XRCC4 antibody
The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.
LGALS14 antibody
LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
Histone H2Ax antibody
The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.
GPR120 antibody
The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.
