Anticuerpos primarios

IL16 antibody is a highly effective polyclonal antibody that specifically targets IL16, a cytokine involved in immune response regulation. This antibody recognizes and binds to the amino group of IL16, neutralizing its activity and preventing it from interacting with its receptors. The IL16 antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to inhibit the growth and proliferation of mesenchymal stem cells and has potential therapeutic applications in cancer treatment. Additionally, this antibody has been used as a tool in studying the role of IL16 in diseases such as asthma, rheumatoid arthritis, and HIV infection. With its high specificity and effectiveness, the IL16 antibody is a valuable tool for researchers in the life sciences field.

Protein C antibody is a highly specialized antibody that targets the activated form of protein C, an important regulator of blood coagulation. This antibody specifically recognizes the active form of protein C and can be used in various research applications, particularly in the field of life sciences.

The C1 inhibitor antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to the C1 inhibitor protein, which plays a crucial role in regulating the complement system. Autoantibodies against the C1 inhibitor can lead to various autoimmune diseases, making this antibody an essential tool for studying these conditions.

Human ESE1 internal region immunogen; affinity purified Rabbit polyclonal ESE1 antibody

TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.

Oxazepam antibody was raised in mouse using BZO-BSA as the immunogen.

The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.

TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Goat anti-rat IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.

Mouse monoclonal PYCRL antibody

Rabbit polyclonal PDGFB antibody

Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.

The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.

Rabbit polyclonal VTI1A antibody

MINA antibody was raised in Rabbit using Human MINA as the immunogen

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page