Anticuerpos primarios

Affinity purified Rabbit polyclonal Hsp105 antibody

Affinity purified Rabbit polyclonal ITIH3 antibody

The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.

Affinity purified Rabbit polyclonal Deltex1 antibody

CDR2L antibody was raised in Rabbit using Human CDR2L as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

JMJD6 antibody was raised in Rabbit using Human JMJD6 as the immunogen

GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Affinity purified Rabbit polyclonal PEBP1 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.