Aminoácidos (AA)

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro30,Tyr32,Leu34)-Neuropeptide Y (28-36) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pz-Pro-Leu-OH is a proteolytic enzyme that cleaves proteins by hydrolysis at the peptide bond. It has been shown to be active against Clostridium and has been used in colorimetric methods for the measurement of this bacterium. Pz-Pro-Leu-OH is produced by subtilisin, which is expressed in Escherichia coli. The amount of this enzyme can be monitored and optimized by cloning. Thermolysin, another protease, also cleaves proteins at the peptide bond and has been used to measure the activity of Pz-Pro-Leu-OH.</p>

<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>

<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>

<p>ACTH (22-39) H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu is a modified form of ACTH (22-39) that is used for the treatment of diabetes mellitus. It is a synthetic peptide and has been shown to reduce body mass index, adipose tissue, and plasma glucose levels in diabetic patients. This drug also increases plasma cortisol concentrations and inhibits insulin production in pancreatic β cells.</p>

<p>Please enquire for more information about H-Gly-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Stresscopin-Related Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-12 is a peptide hormone that belongs to the group of apelin family. It is an endogenous agonist for the apelin receptor and has been shown to affect metabolic and cardiovascular regulation. Apelin-12 has been found to increase systolic blood pressure, which may be due to its ability to inhibit the synthesis of nitric oxide in the heart. It also exhibits anti-inflammatory properties, which have been shown in vivo using a model of colitis induced by dextran sulfate sodium (DSS). The biological properties of this hormone are not yet fully understood. However, it is known that it has effects on cardiac contractility and myocardial infarct size in vivo. Further investigation into this protein's role in inflammatory diseases and metabolic disorders may lead to new treatments for these conditions.</p>

<p>Please enquire for more information about HSV-1 Glycoprotein (gB) (497-507) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-L-Valine N-hydroxysuccinimide ester is a synthetic δ opioid ligand that has been shown to have potent inhibitory activity against casein. The compound has also been shown to have high affinity for opioid receptors and δ opioid receptors, which may be due to its ability to form supramolecular complexes with these proteins. Z-L-Valine N-hydroxysuccinimide ester binds to the receptor binding site of the protein, preventing it from interacting with other molecules. It is not selective for one receptor over another and can bind to both the δ and μ opioid receptors. This synthetic substance may be used as a lead compound in drug development.</p>

<p>N-Benzoyl-L-leucine-beta-naphthylamide is a chromogenic substrate for transpeptidase. It is hydrolyzed to L-phenylalanine and 2-naphthylamine, which react with the chromogen to produce a color change. The reaction occurs in both spermatozoa and epithelial cells, but can be inhibited by aminopeptidase and peptidase. This substrate is used as a marker for spermatozoa in semen analysis.</p>

<p>Please enquire for more information about C-Reactive Protein (CRP) (174-185) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Cys(farnesyl)-OH is a synthetic chemical that has been shown to inhibit the growth of cells. It inhibits the enzyme form of farnesyl protein transferase, which is involved in the synthesis of basic proteins. Ac-Cys(farnesyl)-OH also binds to and inhibits epidermal growth factor receptor, which plays an important role in cell proliferation. In addition, this compound has been found to have anti-cancer properties. Ac-Cys(farnesyl)-OH has been shown to reduce the frequency of cellular transformation in vitro and in vivo. This effect may be due to its ability to inhibit protease activity.</p>

<p>H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Ala-Fmoc)-OH is a synthetic amino acid that is used in peptide synthesis. It is typically prepared by the condensation of Serine with diethyl Fmoc-amino acid and hydrochloric acid. This molecule has an efficient epimerization process, which allows for the synthesis of the other enantiomer, L-Ser(Ala-Fmoc)-OH. The synthetic method for Boc-Ser(Ala-Fmoc)-OH can be used to synthesize peptides from amino acids.</p>

<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>

<p>Please enquire for more information about Angiotensin I/II (1-5) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Tyrosine dipotassium salt is a high quality, reagent, complex compound, useful intermediate and fine chemical. It is a useful scaffold that can be used in the synthesis of various important natural products. L-Tyrosine dipotassium salt is a versatile building block that has been widely applied in research on the development of new drugs, such as antiviral agents and antibiotics. L-Tyrosine dipotassium salt can act as a reaction component for many organic reactions. It also has applications in many areas such as medicine, food production, and environmental protection.</p>

<p>Acetylation is the process of reacting an organic compound with acetic acid to produce an ester and water. Acetylation is one of the most common reactions in organic chemistry. Acetylating agents, such as acetic anhydride or acetyl chloride, are often used in chemical synthesis because they react selectively with primary and secondary alcohols to form esters. The acetylation reaction can be used to modify proteins by attaching an acetyl group to the amine group of a lysine residue. This modification prevents the protein from binding to other proteins and can alter its function. Acetylation also has been implicated in several diseases, such as hepatitis and inflammatory bowel disease.</p>

<p>H-Arg-Arg-Arg-OH acetate salt is a polycarboxylic acid that is found in human immunoglobulins. It has been used as a synthetic substrate for the study of radiation enhancement. H-Arg-Arg-Arg-OH acetate salt is also an allergen and can cause allergic reactions, such as itching and swelling. This compound can be used to study the neutral pH, chemical reactions, protein synthesis, and the hydroxyl group.</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>Please enquire for more information about Fmoc-Tyr-Ala-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>

<p>TIPP is a peptide that belongs to the group of chemokines. It has been shown to have receptor binding activity and to stimulate the release of pro-inflammatory cytokines in cancer cells. TIPP interacts with membranes by forming hydrogen bonds with carbonyl groups and hydroxyl groups, which are located in the membrane. This results in a low energy barrier for intramolecular hydrogen transfer, making it a suitable candidate for drug design. TIPP also interacts with receptors, such as δ receptors, which may contribute to its anti-cancer properties.</p>

<p>Please enquire for more information about Acetyl-Hirudin (55-65) (desulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Phe-Gly-Leu-betaNA is a synthetic peptide that has been shown to bind to glutathione, an antioxidant. It is used in a method for determining the concentration of antioxidants in a sample by injection into the gas phase. The chemical ionisation (CI) and electrospray ionisation (ESI) are used to produce ions from the peptide. The compounds are then separated using chromatography before being quantified by measuring their mass using a mass spectrometer. This process is repeated until all of the antioxidant has been eluted from the column.</p>

<p>Z-Gly-Pro-Ala-OH is a peptidase that hydrolyzes the terminal amino acids from the N-terminal of peptides and proteins. It is used as a drug therapy for neurodegenerative diseases. Z-Gly-Pro-Ala-OH has an acidic active site and can be synthesized in an on-line process. It can be monitored using a number of techniques, including monitoring by bovine serum, kinetic analysis, and analytical methods. The optimum pH for this enzyme is 5.5 to 7.0.</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Please enquire for more information about (4-((2-Methylphenyl)aminocarbonyl)-aminophenyl)acetyl-Fibronectin CS-1 Fragment (1980-1983) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Levomilnacipran is a serotonin-norepinephrine reuptake inhibitor (SNRI) that is used for the treatment of major depressive disorder and fibromyalgia. It has been shown to have antidepressant effects in patients with major depressive disorder and fibromyalgia. Levomilnacipran inhibits the reuptake of serotonin and norepinephrine by blocking the transporter proteins in these neurotransmitter pathways, increasing their availability to interact with receptors in the brain. Levomilnacipran also has been found to inhibit aminotransferase activity, which may be responsible for its hepatotoxicity.</p>

<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys-Pro-OH is a peptide that is derived from the sequence of fibronectin. It has been shown to be taken up by urchin cells, which are spherical and have a toroidal shape. This peptide also has modular properties and forms a particle with a pegylated molecule. The amino acid sequence of this peptide is unmodified. H-Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys Pro -OH is a synthetic ligand that can be used in the ligation of mesenchyme cells.</p>

<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Ala-Pro-OH is a peptide. It is an inhibitor of chymotrypsin, which is an enzyme that breaks down proteins in the stomach. H-Ala-Ala-Pro-OH inhibits this enzyme by forming a covalent bond with the serine residue of chymotrypsin. The inhibition constant (Ki) for H-Ala-Ala-Pro-OH is 8.6 mM, and it has been shown to be stable at pH 2, 4, and 7.</p>

<p>Please enquire for more information about 1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.</p>

<p>ACTH is a hormone that belongs to the class of endogenous peptides. It is synthesized and secreted by the anterior pituitary gland in response to adrenocorticotropic hormone (ACTH) from the hypothalamus. ACTH has a high affinity for cells with receptors for ACTH and has been shown to stimulate cyclase activity, leading to increased production of cAMP. ACTH also binds to membranes and micelles, which are lipid bilayers with hydrophobic regions. The binding of ACTH at these sites alters the physical properties of these structures by increasing their permeability or solubility. This leads to changes in their functions, including modulation of membrane-bound enzymes such as adenylate cyclase activity.</p>

<p>Z-Ala-Gly-Gly-OH is a hydrophobic amino acid that can be used in the treatment of cancers. It has been shown to interact with residues on lysine and aspartic acid, which may be due to its acidic properties. This compound is also able to bind metal ions such as copper and zinc, which may contribute to its anticancer potential. Z-Ala-Gly-Gly-OH also acts as a ligand for anticancer drugs such as carbonyl group or hydroxyl radicals.</p>

<p>Please enquire for more information about Boc-Homoarg-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysine diisocyanate is an organic compound that is a reactive site for the production of calcium stearate and ethylene diamine. It has been shown to be a reactive site in vitro, but not in vivo. L-Lysine diisocyanate reacts with water vapor to produce hydrogen cyanide, which is toxic to cells. The presence of l-lysine can inhibit the formation of hydrogen cyanide, but it also inhibits uptake into cells and tissue cultures.</p>

<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Leu-Gly-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-O-Octadecyl-sn-glycerol (1ODG) is a dietary lipid that is absorbed by the gastrointestinal tract and transported to the liver. It is used in cell culture as a substitute for lipids that are not available or cannot be used for experiments. 1ODG is also found in human lung and colon tissues, where it may act as a growth factor. 1ODG has been shown to inhibit herpes simplex virus type I (HSV-1) replication in cultured cells by increasing intracellular calcium levels and inhibiting viral DNA synthesis. It can also increase fatty acid synthesis and induce cellular proliferation of tissue culture cells, such as lung fibroblasts.</p>

<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>

<p>Please enquire for more information about BIM-23127 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is a heterocyclic peptide that has inhibitory effects on the muscle cells. It inhibits the enzyme guanosine triphosphatase, which is responsible for releasing calcium ions from its intracellular storage site. Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is an analog of the human protein fibronectin, and it can be used as a synthetic molecule to study how integrin receptors interact with different sequences of amino acids.</p>

<p>4-Formylphenyloxymethyl polystyrene resin (200-400 mesh) is a polymer that can be used in the synthesis of amide, aminoacylation, halides, piperidine, yields, imine, reductive amination and heterocycles. It has been shown to be especially useful for the synthesis of diazepinones. The resin is soluble in solvents such as dichloromethane and ethanol. 4-Formylphenyloxymethyl polystyrene resin can be prepared by reacting styrene with formaldehyde and phenol in a solvent such as tetrahydrofuran or pyridine at a temperature between 0°C and 50°C. This process is usually conducted under an inert atmosphere such as nitrogen or argon gas. The resin is then washed with diethylether followed by benzene to remove residual formaldehyde.</p>

<p>Fmoc-D-Ala-OH is a synthetic cyclic peptide that has been shown to have anticancer properties. This compound was synthesized by solid-phase chemistry and exhibits an inhibitory effect on cancer cells. Fmoc-D-Ala-OH blocks the synthesis of proteins in cancer cells, leading to cell death. It also inhibits the activity of serine proteases such as degarelix acetate, which are important for cancer cell growth and metastasis.</p>

<p>Please enquire for more information about Fmoc-D-Cys(Mob)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methyl-2-nitro-3H-imidazol-4-yl)methanol is a fluorescent probe that can be used to detect hypoxic tumor cells. It has been shown to selectively react with the methylethyl group in Trichomonas vaginalis. 3-Methyl-2-nitro-3H-imidazol-4-yl)methanol is bioreductive and can be activated by nitro groups in proteins, which are found in the active site of enzymes such as bacterial dna gyrase. This probe has been shown to bind to the sn38 position of bacterial DNA, but not mammalian DNA.</p>

<p>Please enquire for more information about RFRP-3 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Lys(Z)-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Allatostatin is a type of allatotropin. Allatotropins are a family of neuropeptides that inhibit the release of other hormones, such as vitellogenin, which is a hormone that stimulates vitellogenesis in insect ovaries. Allatostatin inhibits the release of vitellogenin by binding to the receptor on the egg follicle cells and blocking its action. This drug has been shown to be effective at inhibiting mevalonate production in rat ganglia and is also found in high concentrations in holometabolous insects. It is synthesized from an amide precursor by a series of enzymatic reactions and can be desorbed from its storage site with mild acidification.</p>

<p>Fmoc-N-methyl-O-tert-butyl-L-tyrosine is a peptide that mimics the natural substrate serine protease. It has been used to study protein-protein interactions in proteases and their cleavage specificity. This peptide was designed as a peptidomimetic, which is an analog of a protein or peptide. The systematic synthesis of this molecule has been studied extensively and it has been shown that the maximum number of modifications occurs at the N terminus and the minimal number at the C terminus. The residue of this molecule is modified by proteolytic modification, which is a chemical modification that changes the amino acid sequence. Fmoc-N-methyl-O-tert-butyl-L-tyrosine has minimal quantified stability, which means that it can be quantified but not stable for long periods of time.</p>

<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>

<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lauroyl-glycine is a fatty acid with a long acyl chain. It is an intermediate in the synthesis of lauric acid, which is used in the production of detergents and soaps. Lauroyl-glycine has been shown to be useful as a model system for skin condition studies due to its detergent properties.</p>

<p>Please enquire for more information about H-D-ASN-L-ASP-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 12-(Boc-aminooxy)-dodecanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Hydroxymethyl-5-methyl-2-phenylimidazole is an impurity of phenoxy. It has a high resistance to acids and bases, and can be used in devices that require high purity. 4-Hydroxymethyl-5-methyl-2-phenylimidazole has a particle diameter of about 1 micron. This impurity is metastable, or stable only under certain conditions such as temperature and pressure. The high viscosity of this compound makes it useful for devices that require a high degree of stability at elevated temperatures. Immediate decomposition occurs when exposed to air due to the presence of naphthalene, phosphine, and silicon.</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tenofovir is a nucleoside analog reverse transcriptase inhibitor that binds to the RNA-dependent polymerase. This compound is used in combination with other antiviral agents for the treatment of HIV-1 infection and for prophylaxis against HIV-1 infection. Tenofovir has been shown to be effective against infections caused by strains of HIV-1, such as the drug resistant virus. Tenofovir is absorbed rapidly after oral administration, with a bioavailability of over 80%. The prodrug fumarate is hydrolyzed to tenofovir in vivo and this conversion occurs more efficiently in acidic conditions. Alafenamide, a prodrug of tenofovir, has been approved by the FDA as an alternative to tenofovir disoproxil fumarate (TDF) for the treatment of HIV-1 infection. Alafenamide is an acyclic nucleoside phosphonate that inhibits viral replication by inhibiting reverse</p>

<p>Z-Lys(Z)-ONp is an intermediate in the synthesis of lysergic acid diethylamide (LSD). It is a hypotensive agent that has analgesic properties. Z-Lys(Z)-ONp has been patented for use as a hypotensive agent, although it has not yet been approved for this use.</p>

<p>Please enquire for more information about Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-epi-statine (3R,4S)-4-(Boc-amino)-3-hydroxy-6-methyl-heptanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH is a synthetic peptide that has been shown to inhibit the production of angiotensin and angiotensinogen by interfering with the binding of its receptor. It has also been shown to inhibit the production of proinflammatory cytokines, such as tumor necrosis factor alpha (TNFα), interleukin 1beta (IL1β), and IL6, in human macrophages. HAVY can also inhibit toll like receptor 4 mediated inflammatory responses in vivo. HAVY is an inhibitor of angiotensin II type 1 receptor activity, which may be useful in treating cardiovascular diseases such as atherosclerotic lesions, hypertension, and bowel disease.</p>

<p>Inhibitor of hexosamine biosynthetic pathway</p>

<p>Please enquire for more information about Fmoc-Gln(Trt)-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-N-Me-Thr(tBu)-OH·CHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Acetyl-DL-leucine is a non-protein amino acid that has been shown to have a variety of pharmacological effects. It has been found to reduce neuronal death and protect against cerebellar damage. N-Acetyl-DL-leucine acts by binding to the alpha subunit of the glutamate receptor, which increases its affinity for glutamate. This leads to an increased response in neuronal cells, and the prevention of neurotoxicity. N-acetyl-l-leucine has also been shown to be effective as a treatment for vestibular disorders. However, it is only soluble at high concentrations in water, so it cannot be taken orally without first being dissolved in alcohol or another solvent.</p>

<p>4-[1-Hydroxy-2-[(1-methylethyl)amino]ethyl]-1,2-benzenediol sulfate dihydrate (benserazide) is a cholinergic agent that has been shown to increase the release of acetylcholine by acting as an agonist at nicotinic receptors. It increases the amount of acetylcholine released in the brain and can be used for the treatment of Alzheimer's disease. Benserazide has also been shown to have a depressant effect on the respiratory system, which can be beneficial for lung diseases. This drug also has anti-inflammatory properties and can inhibit growth factor synthesis.</p>

<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>

<p>H-Phe-Glu-OH is a compound that has been shown to significantly increase the uptake of collagen in fibrosarcoma cells. H-Phe-Glu-OH binds to a receptor on the cell surface and activates it, which leads to an increase in collagen uptake. This drug also enhances the production of collagen molecules and can be used for diagnosing diseases such as cancer. H-Phe-Glu-OH does not affect normal cells, making it possible for this drug to be used as a diagnostic tool without harming healthy tissue.</p>