Aminoácidos (AA)

<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>

<p>Please enquire for more information about H-Tyr-Ser-Phe-Val-His-His-Gly-Phe-Phe-Asn-Phe-Arg-Val-Ser-Trp-Arg-Glu-Met-Leu-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hydrin 1 is a fatty acid that is expressed in the apical membrane of bladder cells, which are the cells that line the urinary tract. It is also found in the blood vessels and heart. Hydrin 1 has been shown to have biological properties such as being taken up by water, interacting with other molecules, and forming reaction products. The ventral part of the cell membrane is where Hydrin 1 is mostly expressed, but it can also be found in other parts of the organism. Hydrin 1 binds to messenger RNA and has been used as a model system for studying protein-lipid interactions. The effective dose for Hydrin 1 is not known. This drug can be conjugated with bile salts to form an active metabolite called hydroxylinoleic acid (HOLA). HOLA binds to receptors on vascular smooth muscle cells and lowers blood pressure by decreasing peripheral resistance and vascular tone.</p>

<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>Please enquire for more information about Hirudin (55-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pz-Pro-Leu-OH is a proteolytic enzyme that cleaves proteins by hydrolysis at the peptide bond. It has been shown to be active against Clostridium and has been used in colorimetric methods for the measurement of this bacterium. Pz-Pro-Leu-OH is produced by subtilisin, which is expressed in Escherichia coli. The amount of this enzyme can be monitored and optimized by cloning. Thermolysin, another protease, also cleaves proteins at the peptide bond and has been used to measure the activity of Pz-Pro-Leu-OH.</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Fmoc-Ala-Pro-OH is a peroxide that can be used as a radical initiator for the synthesis of polymers, such as polypropylene. It has been shown to catalyze the oxidation of hydrogen peroxide by a phenoxy group to form radicals. The rate of formation of these radicals is highly dependent on the number and location of proline residues in the molecule. Fmoc-Ala-Pro-OH is chemically stable and does not react with oxygen or light.</p>

<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>

<p>The HIV-1 envelope protein, gp120, is a transmembrane glycoprotein that plays a key role in the viral entry process. The gp120 protein contains the binding site for the CD4 receptor and can be cleaved by proteases to remove the membrane-spanning domain. The resulting soluble gp120 (sgp120) is an important co-receptor for HIV infection of target cells such as prostate cancer cells. The sgp120 binds to heparin sulfate proteoglycans on the surface of target cells and triggers cellular activation pathways including angiogenic factors, which induce cell proliferation and migration. This process is important for tumour growth and metastasis, inflammatory bowel disease, and other inflammatory diseases. The sgp120 has also been shown to activate pro-apoptotic proteins such as Bcl-2 family members and Bax. These proteins play a crucial role in apoptosis pathway by regulating mitochondrial membrane integrity, cytochrome c release from mitochond</p>

<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Cysteine hydrochloride anhydrous is an amino acid that is used in the treatment of bowel disease. It is also a precursor for glutathione, which has antioxidant properties and helps maintain iron homeostasis. L-Cysteine hydrochloride anhydrous has been shown to inhibit the oxidation of proteins by reacting with reactive oxygen species (ROS) such as nitric oxide, superoxide, and hydrogen peroxide. This amino acid also interacts with toll-like receptor 4 (TLR4), which may account for its natural anti-inflammatory properties. L-Cysteine hydrochloride anhydrous can be synthesized from cysteine and glutamic acid using a CDNA clone encoding the enzyme cystathionine β-synthase. The synthesis of this amino acid requires a number of biochemical reactions including hydrogen bonding interactions with inhibitor molecules such as dihydrofolate reductase, metalloproteases, and thiored</p>

<p>Please enquire for more information about H-Ser(tBu)-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Glu2)-TRH Pyr-Glu-Pro-NH2 is a colony-stimulating factor that has been shown to play a role in fertility and energy metabolism. It is also involved in the regulation of physiological functions, such as spermatozoa motility and enzyme inhibitors. (Glu2)-TRH Pyr-Glu-Pro-NH2 binds to its receptor on the surface of cells and stimulates cell growth. The biological function of this drug is not yet known.</p>

<p>ACTH (22-39) H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu is a modified form of ACTH (22-39) that is used for the treatment of diabetes mellitus. It is a synthetic peptide and has been shown to reduce body mass index, adipose tissue, and plasma glucose levels in diabetic patients. This drug also increases plasma cortisol concentrations and inhibits insulin production in pancreatic β cells.</p>

<p>Please enquire for more information about H-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Leu-Ser-Glu-Gly-OH is a polypeptide that is hydrophobic and has carboxypeptidase activity. It hydrolyzes anions, such as the penicillin G, which has been shown to have a high affinity for this enzyme. H-Val-Leu-Ser-Glu-Gly-OH has also been shown to interact with other proteins through hydrophobic interactions. When used in high concentrations, it can be used to filter out substances that are hydrophobic. It can also be used to hydrolyze anions and divalent ions, such as copper and zinc.</p>

<p>Please enquire for more information about Ac-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>H-Tyr-Tyr-Tyr-OMe is a chiral, fluorinated, enantiomeric molecule that is synthesized by the reaction of an aryloxybenzene with tetrahydropyran and chlorine. This product has been used in asymmetric synthesis as a building block for pyrazole derivatives. It has also been used to produce alcohols and dialkylamino compounds.</p>

<p>Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.</p>

<p>Please enquire for more information about Z-Leu-Leu-Tyr-a-keto aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (13-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Ala-Val-Ala-pNA is a synthetic peptide that is structurally similar to the natural peptide Vasoactive Intestinal Peptide. The amino acid sequence of this peptide is identical to that of the natural peptide with the exception of two additional amino acids, Ala and Val. Suc-Ala-Ala-Val-Ala-pNA has been shown to have vasoactive properties and it can be used for the treatment of inflammatory diseases such as Crohn's disease. This peptide has also been shown to inhibit protease activity by binding to the reactive site on serine proteases, which are involved in the degradation of extracellular proteins.</p>

<p>Fmoc-D-glu(OtBu)-OH is a homologous molecule that binds to the influenza virus and inhibits its replication. The synthesis of Fmoc-D-glu(OtBu)-OH is achieved by solid-phase peptide synthesis, which involves the ligation of amino acid building blocks on an insoluble carrier resin. This process has been found to be effective for the synthesis of peptides with a variety of amino acid sequences. Fmoc-D-glu(OtBu)-OH has been shown to inhibit the growth and multiplication of Chlorella pyrenoidosa, a single celled green alga, and Paramecium tetraurelia, a protozoan ciliate. It also displays antimycobacterial activity against Mycobacterium tuberculosis in vitro.</p>

<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is an oxime that can be used as a catalyst for the catalytic hydrogenation of nitroalkanes. It is also a precursor to pallimamine, which is used as a pharmaceutical agent and an experimental virucide. Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is synthesized by coupling two indole carboxylic acid analogues in the presence of sodium hydroxide and potassium carbonate. The reaction yields trans-(4'-benzyloxy)-3'-methoxystyrene, which is then converted to the title compound with ammonium chloride and hydrochloric acid. This compound undergoes acidic hydrolysis to yield the title compound.</p>

<p>Hippuryl-Gly-Gly-OH is a small molecule that inhibits the growth of bacteria. It is an inhibitor of epidermal growth factor (EGF) that binds to EGF and blocks its ability to interact with cells. Hippuryl-Gly-Gly-OH also has anti-inflammatory properties and has been shown to be effective against inflammatory bowel disease in vitro. This drug also has been shown to inhibit the enzyme activities associated with inflammatory bowel disease, such as COX2 and iNOS, in human serum, as well as inhibiting the production of proinflammatory cytokines from human peripheral blood mononuclear cells.</p>

<p>Please enquire for more information about H-Leu-Leu-Leu-Phe-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-cis-4-hydroxy-L-proline methyl ester is a synthetic molecule that can be used to synthesize amides. It is typically prepared through a multistep process that begins with the condensation of an acid chloride and an amine. The reaction product is then treated with methyl chloroformate to produce the desired compound, which can be purified by recrystallization. N-Boc-cis-4-hydroxy-L-proline methyl ester has been used in the synthesis of nucleophilic and reactive molecules, as well as industrial processes.</p>

<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Coagulation Factor XIIIa (190-230) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-bNA is a gene product that has been activated and is involved in the production of chronic arthritis. H-Leu-bNA is a basic protein that catalyzes the conversion of chloromethyl ketone to iodoacetic acid, which then converts neutral ph substances to acidic ph substances. This enzyme also catalyzes the conversion of amino acids to their corresponding amines and ammonia. H-Leu-bNA may be involved in autoimmune diseases with acidic phs, such as rheumatoid arthritis. It has an optimum pH of 7.4 and will not work at higher or lower pHs. The sequences for this enzyme are found in plants, but it is not found in humans or animals.br&gt;<br>H-Leu-bNA can be used as a kinetic tool to measure enzyme activity. Kinetic data for this enzyme show that it has a high affinity for chloromethyl ketone and can be inhibited by certain chemicals,</p>

<p>Please enquire for more information about Amyloid beta-Protein (1-46) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-1-Nal-Abu-Phe-psi(CH2NH) Abu-Abu-1-Nal-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about Z-D-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Asn-Arg-Val-Tyr-Val-His-Pro-Phe (HAV) is a small molecule that is a member of the ubiquitin ligase family. This drug has been shown to have a variety of biological effects, including cardiac and bowel disease, as well as hypertension. HAV has also been shown to reduce the risk of heart failure in people with chronic kidney disease. HAV binds to the protein PCSK9 and inhibits its function by binding to the epsilon site on PCSK9. This leads to an increase in low density lipoprotein cholesterol and a decrease in high density lipoprotein cholesterol levels. HAV also has an amide group that allows it to inhibit angiotensin II and act as a pressor agent.</p>

<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>

<p>4-Amino-2-methylbenzoic acid is a low molecular weight compound that has been shown to inhibit the neuraminidase enzyme. It interacts with the imine group of the enzyme and forms a covalent bond, which prevents the release of sialic acid from the terminal sugar residue of glycoproteins. The inhibition of this enzyme leads to decreased bacterial growth. 4-Amino-2-methylbenzoic acid has been shown to be active against Gram positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae, but not against Gram negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. This compound is also able to inhibit the synthesis of c-reactive protein (CRP) in human erythrocytes.</p>

<p>4-Methylsulphonylaniline is a reactive compound that can be used as an anticancer agent. It is a quinoline derivative and has been found to have potent antitumor activity against various cancer cell lines, including those resistant to other anticancer agents. The activation energy of this compound is high at 93 kcal/mol and it has been found to react with dimethylformamide (DMF) in the reaction mechanism. 4-Methylsulphonylaniline has also been shown to inhibit the growth of tumor cells in mice by inhibiting DNA synthesis. This molecule also causes DNA damage in cultured cells. 4-Methylsulphonylaniline may also cause environmental pollution because it reacts with sulfadiazine, which is a drug used for the treatment of chronic infections caused by bacteria such as Salmonella typhi and Mycobacterium tuberculosis, leading to the release of methyl sulfone, which can be toxic to aquatic</p>

<p>Ac-Trp-Glu-His-Asp-AMC is a monomer that is expressed by baculoviruses. Cryo-electron microscopy has shown that Ac-Trp-Glu-His-Asp-AMC oligomerizes in the presence of caspase inhibitors. This polypeptide also activates caspase 1, which is involved in the inflammatory response. The activation of this enzyme is dependent on the proteolytic activity of the polypeptide and its stereoisomers. Acetylcholine receptor antagonists, such as coumarin derivatives, inhibit the activity of Ac-Trp-Glu-His-Asp AMC and suppress inflammation.</p>

<p>H-Phe-Gly-Gly-Phe-OH is a tetrapeptide that is synthesized by the enzyme pepsin in a high concentration. Pepsin cleaves proline from the sequence (H-Phe-Gly) and replaces it with hydroxylated phenylalanine. The peptide is soluble in 0.1 M sodium acetate, pH 5.0, but precipitates at pH 4.0 or below. It binds to sephadex G100 but not to Sepharose CL4B or Sephadex G25M, and can be denatured by heating to 100°C for 10 minutes or by exposure to metal ions such as copper(II) sulfate. H-Phe-Gly-Gly-Phe-OH has been used as an analog for the amino acid sequence Gly-Leu in order to study its effects on receptor affinity and protein stability.br&gt;br</p>

<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Methylpyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mbs-D-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>H-Gly-Cys-Gly-OH is an amino acid sequence that has been evaluated for its interactions with other amino acids and proteins. It is a tripeptide heterocycle and can be found in the tissues of many organisms, including humans. H-Gly-Cys-Gly-OH can be found in bovine serum and has been shown to have reversed phase high performance liquid chromatography activity. This molecule also interacts with reversed phase high performance liquid chromatography, ion exchange, and tripeptides.</p>

<p>Bz-Phe-Val-Arg-AMC is a synthetic substrate that is used to measure proteolytic activity. It has been shown to be hydrolyzed by serine proteases, such as trypsin and chymotrypsin, at a rate proportional to the enzyme's concentration. The rate of hydrolysis was determined using a kinetic assay in which the release of AMC from the peptide bond was measured using an ultraviolet spectrophotometer. Bz-Phe-Val-Arg-AMC has also been used to study the effects of various food additives on proteolytic activity. This test can be used as a diagnostic tool for inflammatory diseases, such as Crohn's disease and ulcerative colitis.</p>

<p>H-Gly-Pro-Gly-OH is a glycan molecule. It is an artificially synthesized glycan that was designed to act as a neutralizing agent for HIV. It binds to the envelope protein gp120 and prevents it from binding to CD4 receptors on cells, thereby preventing viral entry into the cell. H-Gly-Pro-Gly-OH has also been shown to be effective in neutralizing collagenase activity, which may be useful in treating arthritis and other autoimmune disorders.<br>H-Gly-Pro-Gly-OH has been shown to bind to monoclonal antibodies that are used in the development of cancer treatments, such as Herceptin and Erbitux. This binding is thought to be due to sequences within the antibody that correspond with those found on gp120, the envelope protein of HIV.</p>

<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tenofovir is a nucleoside analog reverse transcriptase inhibitor that binds to the RNA-dependent polymerase. This compound is used in combination with other antiviral agents for the treatment of HIV-1 infection and for prophylaxis against HIV-1 infection. Tenofovir has been shown to be effective against infections caused by strains of HIV-1, such as the drug resistant virus. Tenofovir is absorbed rapidly after oral administration, with a bioavailability of over 80%. The prodrug fumarate is hydrolyzed to tenofovir in vivo and this conversion occurs more efficiently in acidic conditions. Alafenamide, a prodrug of tenofovir, has been approved by the FDA as an alternative to tenofovir disoproxil fumarate (TDF) for the treatment of HIV-1 infection. Alafenamide is an acyclic nucleoside phosphonate that inhibits viral replication by inhibiting reverse</p>

<p>Please enquire for more information about Band 3 Protein (824-829) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>

<p>Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Phe-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Arg(Pbf)-allyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-alpha-Fmoc-Nbeta-allyloxycarbonyl-L-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Trp-Glu-His-Asp-aldehyde is a tetrapeptide that has been shown to inhibit the activity of caspases. Caspases are proteases that play an important role in cell death by inducing apoptosis and necrosis. The structure of the Ac-Trp-Glu-His-Asp-aldehyde was determined by X-ray crystallography, revealing a hydrophobic molecule with a pseudo acid residue. This compound binds to peptides and blocks the binding site for caspase substrates, which prevents their activation. Acetylation of this compound also increases its hydrophobicity, making it more likely to bind to other molecules such as proteins or lipids.</p>

<p>4-Methylsalicylamide is a chemical compound that belongs to the class of isonicotinic amides. It is a potent anti-inflammatory agent with minimal inhibitory concentration (MIC) values of 4 µg/mL for gram-positive bacteria and 8 µg/mL for gram-negative bacteria. This compound has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. 4-Methylsalicylamide has been shown to have an inhibitory effect on ring-opening, which may be due to its ability to acetylate mitochondrial membranes, altering the membrane potential. The molecular modeling studies also showed that 4MSAM binds at the same site as antibiotics such as penicillin and erythromycin in bacterial ribos</p>

<p>L-Tyrosine ethyl ester hydrochloride is a non-protein amino acid that inhibits the activity of metalloproteases, which are enzymes that break down proteins. It has been shown to be effective against bowel disease and cancer by inhibiting the release of inflammatory cytokines. L-Tyrosine ethyl ester hydrochloride also has anti-inflammatory properties and can be used in the treatment of depression and liver cirrhosis. This drug is an inhibitor of hydroxylase, which is an enzyme involved in the synthesis of melanin. It is a structural analogue to L-DOPA, which is used for Parkinson's disease. L-Tyrosine ethyl ester hydrochloride has been shown to have antihypertensive effects and can be used as a diuretic agent.</p>

<p>Please enquire for more information about (D-Pro4,D-Trp7·9·10,Val8)-Substance P (4-11) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-Phe-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>Please enquire for more information about IGF-I Analog including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr(tBu)-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 is an opioid receptor agonist with a high affinity for the μ-, δ-, and κ-opioid receptors. Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 binds to these receptors, thereby inhibiting the release of neurotransmitters that transmit pain signals from the peripheral nerves to the brain. Acetyl fentanyl also inhibits the binding of opioid receptor antagonists such as naloxone, which is used in emergency rooms to block or reverse the effects of opioids. Acetyl fentanyl has been shown to be an effective analgesic in animal studies.</p>

<p>Carboxymethyl-Phe-Leu-OH (CMPLE) is a metalloprotease inhibitor that inhibits the activity of proteases, such as serine proteases and cysteine proteases. CMPLE is used to treat infectious diseases caused by bacteria, fungi, or parasites. CMPLE also has been shown to inhibit the formation of inflammatory responses in autoimmune and inflammatory diseases. This drug can be used in combination with benzalkonium chloride or monoclonal antibodies to treat hematopoietic cells. The optimum pH for this drug is 7.5, and it denatures at high temperatures. It also binds to epithelial surface glycoproteins in the gastrointestinal tract and may be useful for treating ulcers caused by Helicobacter pylori infection.</p>

<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>

<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>

<p>Please enquire for more information about (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>