Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29634 productos de "Péptidos"
Intermedin (human)
Catalogue peptide; min. 95% purity
Fórmula:C219H351N69O66S3Peso molecular:5,102.84 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Fórmula:C147H227N39O43SPeso molecular:3,260.75 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111727
Producto descatalogadoα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C40H61N11O9Peso molecular:840.00 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Fórmula:C46H68N10O14SPeso molecular:1,017.17 g/molH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Fórmula:C46H75N9O11S2Peso molecular:994.28 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Fórmula:C61H94N18O16Peso molecular:1,335.5 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Fórmula:C46H59N7O12Peso molecular:902.02 g/molα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Fórmula:C44H67N13O9Peso molecular:922.11 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Fórmula:C82H122N22O25SPeso molecular:1,848.08 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Fórmula:C190H288N54O57Peso molecular:4,240.64 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/molRef: 3D-FS108741
Producto descatalogadoCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Fórmula:C124H205N39O39S2Peso molecular:2,930.38 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Fórmula:C114H174N30O42SPeso molecular:2,668.90 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Fórmula:C48H86N18O16Peso molecular:1,171.33 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Fórmula:C61H108N25O22PPeso molecular:1,574.69 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Fórmula:C123H195N31O39Peso molecular:2,732.04 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C80H137N19O25Pureza:Min. 95%Peso molecular:1,765.06 g/molRef: 3D-FT109022
Producto descatalogadobeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Fórmula:C86H151N31O26S2Peso molecular:2,099.48 g/molZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C19H28N2O5Pureza:Min. 95%Peso molecular:364.44 g/molRef: 3D-FI111494
Producto descatalogadobeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Fórmula:C22H26N4O6Peso molecular:442.48 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
