
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29863 productos de "Péptidos"
L-Histidyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide Acetate Salt
CAS:Producto controladoFórmula:C46H56N12O6·x(C2H4O2)Forma y color:NeatPeso molecular:873.01 + x(60.05)NG-Monomethyl-L-arginine Acetate
CAS:Producto controladoFórmula:C7H16N4O2·C2H4O2Forma y color:NeatPeso molecular:248.28H-Beta-Ala-pNA HBr
CAS:Producto controladoFórmula:C9H11N3O3·HBrForma y color:NeatPeso molecular:290.114DOTA-tris (t-Bu ester) (~90%)
CAS:Producto controladoApplications DOTA-tris (t-Bu ester), is a Bifunctional chelator, that can be used in the preparation of gadolinium complexes as MRI blood contrast agents.
Fórmula:C28H52N4O8Pureza:~90%Forma y color:NeatPeso molecular:572.73Poly(ethylene Glycol) ~400
CAS:Applications Poly(ethylene Glycol) ~400 is a polymer of ethylene oxide with a molecular weight of ~400 Daltons. Poly(ethylene Glycol) ~400 is considered a low molecular weight polyethylene glycol, and is used as a hydrophilic molecular probe for measuring intestinal permeability. Poly(ethylene Glycol) ~400 is also used as a hydrophilic plasticizer.
References Lu, E., et al.: J. Control. Release, 92, 375 (2003); Ma, T., et al.: Gastroenterology, 98, 39 (1990)Fórmula:H2O(C2H4O)nForma y color:ColourlessPeso molecular:62.07MG-101 (ALLN)
CAS:Producto controladoApplications MG-101 (ALLN) is a potent inhibitor of cysteine proteases including caplains and cathespins. Used in the treatment of genotoxic agents or replication stress of cells. Neuroprotective product.
References Wang, H. et al.: Biochem., 54, 5781 (2015); Fukunaga, Y. et al.: Neurosci. Res., 101, 6 (2014);Fórmula:C20H37N3O4Forma y color:NeatPeso molecular:383.53Doxorubicin Hydrochloride
CAS:Stability Hygroscopic, Light Sensitive
Applications Doxorubicin Hydrochloride is an antineoplastic agent.
References Di Marco, A., et al.: Cancer Chemother. Rep., (part 1), 53, 33 (1969); Mihich, E. and Ehrke, M.J.: Transplant. Proc., 16, 499 (1984);Fórmula:C27H29NO11·ClHForma y color:NeatPeso molecular:579.98Cyclo(Leu-Gly)
CAS:Producto controladoApplications Cyclo(Leu-Gly) is an antimicrobial compound produced by Latobacillus plantarum.
References Niku-Paavola, M., et al.: J. Appl. Microbiol., 86, 29 (1999)Fórmula:C8H14N2O2Forma y color:Off-WhitePeso molecular:170.21Poly(ethylene Glycol) ~4000
CAS:Producto controladoFórmula:H2O(C2H4O)nForma y color:White To Off-WhitePeso molecular:62.07E-64d
CAS:Producto controladoApplications E-64d is an inhibitor of cathepsins B and L as well as a potential inhibitor of calpain. E-64d has been shown to inhibit lysosomal proteases. E-64d has been used in combination with Prepstatin A to interfere with autolysosomal digestion. E-64d displays neurovascular and neuronal protective effects after focal cerebral ischemia in rats.
References Wilcox, D. et al.: Biochem. J., 285, 495 (1992); McGowan, E.B. et al.: Biochem. Biophys. Res. Comm., 158, 432 (1989); Tsubokawa, T. et al.: J. Neurosci. Res., 84, 832 (2006);Fórmula:C17H30N2O5Forma y color:NeatPeso molecular:342.43N,N'-Dicyclohexylcarbodiimide
CAS:Producto controladoFórmula:C13H22N2Forma y color:Off-White To Light YellowPeso molecular:206.33CY5-SE
CAS:CY5-SE (Cy5 NHS Ester) is a reactive dye used to label amino groups in peptides, proteins, and nucleotides.Fórmula:C37H43N3O10S2Pureza:99.56%Forma y color:SolidPeso molecular:753.88Glycyl-Glycyl-Glycine
CAS:Producto controladoApplications Glycyl-glycyl-glycine is used as a model peptide for studies of physicochemical parameters and molecular associations of small peptides. It is also used as a copper chelator.
Fórmula:C6H11N3O4Forma y color:NeatPeso molecular:189.17N-CBZ-Glycyl-glycyl-L-arginine 7-Amido-4-methylcoumarin Hydrochloride
CAS:Applications N-CBZ-Glycyl-glycyl-L-arginine 7-Amido-4-methylcoumarin Hydrochloride is a fluorogenic substrate for uPA (urokinase).
References Zimmerman, M., et al. Proc. Natl. Acad. Sci. USA 75, 750 (1978);Fórmula:C28H33N7O7·HClForma y color:NeatPeso molecular:579.6AEBSF Hydrochloride
CAS:Producto controladoApplications AEBSF Hydrochloride is an irreversible serine protease inhibitor.
References Diatchuk, V., et. al.: J. Biol. Chem., 272, 13292 (1997)Fórmula:C8H11ClFNO2SForma y color:NeatPeso molecular:239.69Urolithin A
CAS:Applications Urolithin A is a major metabolite of ellagitannin and exhibits anti-inflammatory and antioxidant properties.
References Ishimoto, H., et. al.: Bioorg. Med. Chem. Lett., 21, 5901 (2011);Fórmula:C13H8O4Forma y color:NeatPeso molecular:228.2L-gamma-Glutamyl-L-valine
CAS:Applications H-Glu(Val-OH)-OH (CAS# 2746-34-1) is a useful research chemical compound.
Fórmula:C10H18N2O5Forma y color:NeatPeso molecular:246.26N-Boc-D-leucine
CAS:Producto controladoApplications N-Boc-D-leucine is an N-Boc-protected form of D-Leucine (L330150). D-Leucine is an unnatural isomer of L-Leucine (L330110) that acts as an auto-inhibitor of lactic streptococci in culture. D-Leucine causes analgesia in humans and also exhibits inhibitory activity in bacterial cell cultures.
References Chuan, Y., et al.: Chin. J. Anim. Vet. Sci., 4, 003 (1985); Fox, S., et al.: J. Biol. Chem., 155, 465 (1944); Gillillad, S. & Speck, M.: J. Dairy Sci., 51, 1573 (1968); Schoenheimer, R., et al.: J. Biol. Chem., 130, 703 (1939); Seltzer, S., et al.: Pain, 11, 141 (1981)Fórmula:C11H21NO4Forma y color:NeatPeso molecular:231.29Benzotriazol-1-yl-oxytripyrrolidinphosphonium Hexafluorophosphate
CAS:Producto controladoApplications Benzotriazol-1-yl-oxytripyrrolidinphosphonium Hexafluorophosphate (cas# 128625-52-5) is a compound useful in organic synthesis.
Fórmula:C18H28N6OP·F6PForma y color:NeatPeso molecular:520.39Ethyl Cyano(hydroxyimino)acetate
CAS:Producto controladoApplications Ethyl Cyano(hydroxyimino)acetate is used in peptide synthesis and has shown to suppress racemiztion, has high coupling efficiency in both solution and solid phase synthesis and is a non-explosive alternative to 1-hydroxybenzotriazole (HOBt) and 1-hydroxy-7-azabenzotriazole (HOAt).
References Khattab, S.N.: Bull. Chem. Soc. Jpn., 83, 1374 (2010)Fórmula:C5H6N2O3Forma y color:NeatPeso molecular:142.11DAPT
CAS:Applications DAPT is a γ-secretase inhibitor which inhibits thegrowth of cancer cells and epethelial and mesenchymal transition (1,2).
References (1) Li, L. et al.: Oncol Lett. 7, 2160 (2014) (2) Wang, M. et al.: Int. J. Onc., 44, 1401 (2014)Fórmula:C23H26F2N2O4Forma y color:Off White SolidPeso molecular:432.46tert-Butoxycarbonyl-D-proline
CAS:Producto controladoApplications tert-Butoxycarbonyl-D-proline is Boc protected D-proline (P755990). It is used to prepare trichostatin A and trapoxin B analogs as histone deacetylase inhibitors. It is also used to prepare potent and selective nonpeptide inhibitors of caspases 3 and 7.
References Jung, M., et al.: Bioorg. Med. Chem. Lett., 7, 1655 (1997); Lee, D., et al.: J. Med. Chem,, 44, 2015 (2001)Fórmula:C10H17NO4Forma y color:NeatPeso molecular:215.25L-Alanyl-L-alanyl-L-alanine
CAS:Producto controladoApplications L-Alanyl-L-alanyl-L-alanine (cas# 5874-90-8) is a useful research chemical.
Fórmula:C9H17N3O4Forma y color:White To Off-WhitePeso molecular:231.25KHLF-[AMC]
Peptide substrate for the kallikrein-related peptidase 7 (KLK7), the most abundant KLK family protease in the stratum corneum (outermost layer of the epidermis). KLK family have been implicated in several key homeostatic processes and in skin diseases that feature impaired desquamation. Increased levels of KLK7, have been identified in the stratum corneum of patients with atopic dermatitis (AD). T-helper type 2 cytokines, including interleukin 4 (IL-4) and-IL-13, can stimulate expression of KLK7, suggesting a direct link between inflammation in AD and KLK7 levels.KLK7 cleaves its substrates after tyrosine or phenylalanine residues. This peptide contains a C-terminal 7-amino-4-methylcoumarin (AMC) fluorescent tag, which is quenched when linked to the peptide via the amide bond. AMC is cleaved from the peptide by KLK7, upon cleavage the AMC fluorescence is activated.Forma y color:PowderPeso molecular:700.4 g/molAlbumin (237-251) Bovine
Albumin (237-251) Bovine is derived from the globular protein Albumin and is found in the blood-plasma of humans (known as Human Serum Albumin, HSA) where it serves to maintain plasma pressure and nutritional balance. Another role it carries out is the transportation of bound molecules through the blood. Bovine serum albumin (BSA), composed of 583 amino acids, is very similar to HSA thus allowing BSA to be used as a successful model and a standard protein in laboratory experiments.Although BSA and HAS share homology in their three domains, I, II and III, BSA contains 2 tryptophan whereas HAS only contains 1 tryptophan residue.In agriculture the presence of the albumin protein has been used to assess the health of cows to ensure that a suitable quality of milk and meat are produced. Moreover it is important to detect bovine albumin in food and pharmaceutical products due to it being an allergenic protein.Forma y color:PowderPeso molecular:1,792 g/molPolyproline-13
Polyproline-13 (Pro13) forms a helix, and it is a naturally occurring secondary structure. Pro13 is used as a model peptide to help understand the folding mechanisms and intermediates of the proteome. Pro13 can exist in a cis-orientation leading to the formation of the right-handed PPI helix- this is more favourable in non-polar solvents. Alternatively, Pro13 can have a trans-orientation leading to a left-handed PPII helix favoured in polar solvents. Pro13 can interchange these forms by altering the solvent composition, as determined by circular dichronism spectroscopy. The ability to observe the reversible transition between PPI and PPII, and its intermediates, has been hampered by a lack of methodologies, and thus the mechanistic pathway remains unclear. There is PPII helix content in proteins, and the role that PPII conformations play in the non-structured state of polypeptides is still being investigated. Free energy landscapes of polyprolines in various solvents have helped to understand their relative stability and improve the information about the transition pathway between the helices.Peso molecular:1,279.7 g/molC5A
C5A is an anaphylatoxin produced along with C5b, by the cleavage of complement C5, a fundamental factor of the complement system pathways.Peso molecular:2,310.1 g/molClick SynB3
SynB3 is a cell-penetrating peptide (CPP) with high efficacy at crossing the cell membrane with no significant toxicity. SynB3, like other CPPs, can cross the blood-brain barrier (BBB). Although the mode of crossing remains unclear, synB3 has been conjugated to a few cargoes and shown to be adequately present in the brain. Synb3 provides promise for the delivery of antisense oligonucleotides as therapy for conditions such as Duchenne muscular dystrophy (DMD) and spinal muscular atrophy (SMA). The treatment of these conditions has been hampered by the lack of cargo delivery methods that can be tissue-specific and cross the BBB. SynB3 in mouse models was shown to be an effective method of delivering therapeutics across the BBB for SMA treatment.SynB3 is labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide). Azide-alkyne cycloaddition has become the most popular Click reaction. Alkyne-synB3 allows various applications, particularly for protein conjugation, modification, and drug delivery.
Forma y color:PowderPeso molecular:1,474.8 g/molBiotin-PEG2-Claudin-6
Biotin-PEG2-Claudin-6 is derived from the tight junction protein Claudin-6 which is encoded by the CLDN6 gene and can be found within epithelial cell to cell contacts. The Claudin family are transmembrane proteins containing two extracellular loops and are involved in maintaining cell polarity and controlling paracellular ion flux.The expression of Claudin-6 is most commonly seen in early embryonic development where it plays a role in the regulation of blastocyst formation through tight junction enhancement. It is also an important factor for epidermal differentiation and barrier formation. Although it is more commonly seen in embryonic development it is also expressed in mammary epithelial cells. Studies have also shown Cldn6 to be a tumour suppressor in breast cancer.This peptide has a covalently bonded N-terminal Biotin tag that can be used for detection and purification and contains a polyethylene glycol spacer (PEG2).Forma y color:PowderPeso molecular:2,924.5 g/mol(N-Cbz-Nle-KRR)2-[Rh110]
Fluorogenic peptide substrate for flavivirus non-structural 3 (NS3) and non-structural 2B/3 (NS2B/3)- highly conserved serine proteases that performs several enzymatic functions critical for virus replication. The flaviviruses include: zika virus- west nile virus- dengue virus- yellow fever virus, and tick-borne encephalitis. Flaviviruses require proteolytic processing of polyprotein precursors to yield a functional viral particle. This processing is carried out by the two-component protease, consisting NS2B a small integral membrane protein, and NS3, a cytosolic protein. In its intact state this peptide is not fluorescent, however this substrate peptide is cleaved by NS3 or NS2B serine proteases in two successive steps to release Rhodamine 110. Upon rhodamine 110 fluorophore release fluorescence can then be detected. This peptide therefore allows for the quantification of NS3/ NS2B/3 serine protease activity. Rhodamine 110 is a widely used red fluorescent probe.
Peso molecular:1,706 g/molSIVmac239 - 15
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,538.9 g/molH-Nle-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Nle-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin that is used as a building block for peptide synthesis. It is an alcohol resin that contains amines, thiols, and alcohols. This resin has been shown to be useful in the synthesis of peptides and proteins.Pureza:Min. 95%CMV pp65 (Human, 495-503)
CMV pp65 (Human, 495-503) is an immunogenic peptide, which is derived from the Human Cytomegalovirus (HCMV) phosphoprotein pp65. Also known as CEF20 or Cytomegalovirus pp65 (495-503), this peptide is a fragment of a viral protein known to play a significant role in the immune response to CMV infection. The source of this peptide is the viral protein itself, specifically a conserved region within it.The mode of action involves its recognition by cytotoxic T lymphocytes (CTLs), which are crucial for evaluating cellular immune responses in research settings. Researchers use it to monitor and study immune responses to HCMV, particularly in contexts involving immunocompromised individuals such as transplant recipients, where CMV infection poses significant risks.In applications, CMV pp65 (495-503) is primarily utilized in immunological studies, including T-cell assays and vaccine research, to better understand the dynamics of immune responses to CMV. Its role in scientific investigations is central to developing therapeutic strategies and diagnostic tools related to CMV and other related viral infections.Fórmula:C42H74N10O12SPureza:Min. 95%Peso molecular:943.18 g/molHXB2 gag NO-115
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,607.7 g/molFmoc-Asp(OtBu)-Rink-Amide MBHA Resin
Fmoc-Asp(OtBu)-Rink-Amide MBHA Resin is a building block for peptides. It is an acid labile resin that can be cleaved with TFA to provide amine-protected dipeptides and tripeptides. This product is used as a building block for peptide synthesis.
Pureza:Min. 95%Abz-Ser-Pro-Tyr(NO2)-OH
Abz-Ser-Pro-Tyr(NO2)-OH is a peptide that has been shown to be an angiotensin I converting enzyme II (ACE) substrate and an inhibitor of ACE. It also inhibits the release of renin from the juxtaglomerular apparatus, which is needed for the production of angiotensin II. This peptide is used in biochemical research and as a standard for measuring enzymatic activity.Fórmula:C24H27N5O9Pureza:Min. 95%Peso molecular:529.51 g/molH-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
H-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a peptide that binds to the integrin αvβ3, which is expressed on many types of cancer cells. This binding causes cell death by apoptosis. H-AEEEA-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 also has the potential to be used as an imaging agent for tumor detection and diagnosis.Fórmula:C67H102N20O22Pureza:Min. 95%Peso molecular:1,539.68 g/molH-DSTGSFVLPFR^-OH
Peptide H-DSTGSFVLPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FMRF-like neuropeptide flp-7-2
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C55H93N19O15S2Peso molecular:1,324.5 g/mol[Sar1]-Angiotensin II
CAS:Producto controladoAngiotensin II is a peptide hormone that is secreted by the kidneys. It stimulates the release of aldosterone and causes vasoconstriction, leading to an increase in blood pressure. Angiotensin II is also involved in other physiological functions such as the regulation of fluid balance, electrolyte levels, and blood coagulation. The drug is used to treat congestive heart failure and high blood pressure. Sar1-Angiotensin II has been shown to inhibit transcriptional regulation by binding to the angiotensin receptor type 1 (AT1). This binding disrupts conformational changes in the receptor, preventing signal transduction from occurring and decreasing the activity of enzymes such as protein kinase A, which are needed for activation of transcription factors.Fórmula:C49H71N13O10•(C2H4O2)2Pureza:Min. 95%Peso molecular:1,122.28 g/molPresenilin 1 (349-361)
Presenilin 1 (349-361) is a peptide that is a substrate for glycogen synthase. It is cleaved from the precursor protein presenilin 1 and has a molecular weight of 4.5 kDa. Presenilin 1 (349-361) is an enzyme substrate that can be used in biochemical assays to research glycogen metabolism.Fórmula:C56H93N21O19Pureza:Min. 95%Peso molecular:1,364.49 g/molH-LTQLGTFEDHFLSLQR^-OH
Peptide H-LTQLGTFEDHFLSLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) is a resin that contains amines and thiols. It can be used as a building block of peptides and proteins. H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) can also be used in the synthesis of alcohols, which are important chemicals for industry.
Pureza:Min. 95%TentaGel® HL-NH2 Resin
TentaGel resin; constructed with a backbone of low cross-linked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. TentaGel; HL (High Load) (mean particle size 110 µm: capacity 04-06 meq/g)Pureza:Min. 95%H-DAVTYTEHAK^-OH
Peptide H-DAVTYTEHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FK18
FK18 is a basic fibroblastic growth factor that has been shown to promote neuronal survival and is neuroprotective. It also can prevent glutamate-induced neurotoxicity in the central nervous system (CNS) by inhibiting glutamate release from the synaptic cleft, which leads to neuronal death. FK18 has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins and other inflammatory mediators. FK18 has also been shown to reduce necrotic cell death by decreasing mitochondrial membrane potential.Fórmula:C107H155N31O31Pureza:Min. 95%Peso molecular:2,371.62 g/molH-Pro-Val-OH
CAS:H-Pro-Val-OH is an amide that is used to treat renal disorders by inhibiting leukocyte elastase. It has been shown to be a potent inhibitor of serine proteases, including chymotrypsin and trypsin. H-Pro-Val-OH binds to the active site on serine proteases and blocks the release of peptides from the enzyme. The binding constant for H-Pro-Val-OH with chymotrypsin was found to be in the range of 3 x 10 M, which is significantly higher than that for other amides. In addition, H-Pro-Val-OH inhibits cytolysis by lysosomal enzymes and protects against liver injury caused by chronic liver disease. This drug also shows low molecular weight and high water solubility, making it effective in treating acute hepatitis.
Fórmula:C10H18N2O3Pureza:Min. 95%Forma y color:PowderPeso molecular:214.26 g/molrec IL-4 (murine)
CAS:Please enquire for more information about rec IL-4 (murine) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%H-Phe-Pro-OH
CAS:H-Phe-Pro-OH is a cyclic peptide that is a structural mimic of the natural amino acid gamma-aminobutyric acid (GABA) and has been shown to be an effective inhibitor of the p450 enzymes responsible for carcinogen activation. The peptide binds to response elements in DNA and RNA, which prevents transcription of genes that are involved in cancer development. H-Phe-Pro-OH also inhibits collagen production and has hemolytic activity due to hydrogen bonding with erythrocytes. This peptide can be used as an antimicrobial agent against Gram negative bacteria, including Pseudomonas aeruginosa, Klebsiella pneumoniae, Escherichia coli, and Salmonella typhimurium. In addition, it has been shown to inhibit the growth of Gram positive bacteria such as Staphylococcus aureus and Clostridium perfringens. The mechanism by which this compound inhibits bacterial growth is
Fórmula:C14H18N2O3Pureza:Min. 95%Forma y color:PowderPeso molecular:262.3 g/molAg85B (41-61)
Please enquire for more information about Ag85B (41-61) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C73H113N19O23SPeso molecular:1,674.87 g/molH1 native 4-peptide mixture
H-VNSVIEK-OHH-EQLSSVSSFER-OHH-TLDYHDSNVK-OHH-ITFEATGNLVAPR-OHPeptide purity: >98%AAA: Concentration - Duplicate kit contains 100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquotsH-YLEPGPVTV^-OH
Peptide H-YLEPGPVTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H1 labeled 4-peptide mixture
H-VNSVIEK^-OHH-EQLSSVSSFER^-OHH-TLDYHDSNVK^-OHH-ITFEATGNLVAPR^-OHR^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)Peptide purity: >98%AAA: Concentration - Duplicate100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquotsAnoga-HrTH hormone
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C47H64N10O11Peso molecular:945.07 g/mol1,2-Dimyristoyl-rac-glycerol
CAS:1,2-Dimyristoyl-rac-glycerol (1,2-DMG) is a monomolecular fatty acid that has been found to inhibit the replication of herpes simplex virus. It binds to the surface glycoprotein and inhibits the release of diacylglycerol from the lipid membrane. 1,2-DMG also inhibits the activity of acyl chain enzymes, which are necessary for the synthesis of fatty acids in trypanosomes. This inhibition prevents the growth and proliferation of lung fibroblasts and may be beneficial in treating cancer. The ionisation mass spectrum shows that 1,2-DMG has a molecular weight of 270 Da. The binding affinity between 1,2-DMG and water is 9 x 10 M at room temperature.Fórmula:C31H60O5Pureza:Min. 90%Forma y color:White PowderPeso molecular:512.81 g/molZ-Ile-Ser-OH
CAS:Z-Ile-Ser-OH is a fine chemical that belongs to the group of useful scaffolds and versatile building blocks. It is a useful intermediate in research and as a reaction component in speciality chemicals. Z-Ile-Ser-OH has been shown to be an excellent reagent for complex compounds. This compound is used as a building block for pharmaceuticals, agrochemicals, and other chemicals. Z-Ile-Ser-OH has high quality and can be used as a research chemical or as an intermediate for other chemical syntheses.Fórmula:C17H24N2O6Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:352.38 g/molα-CGRP (mouse, rat)
CAS:Endogenous calcitonin gene-related peptide receptor (CGRP) agonist which is secreted in both peripheral and central neurons. It is a potent vasodilator and can function in the transmission of nociception as well as acting as an appetite suppressant and contributing to gastric acid secretion. It also has a function in temperature homeostasis, increases heart rate, and can play a role in the release of the pituitary hormone.Fórmula:C162H262N50O52S2Pureza:Min. 95%Forma y color:PowderPeso molecular:3,806.25 g/molH3(1-14)K4me3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTEPVSELLK^-OH
Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SMAP 29, Sheep Myeloid
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C146H260N52O32Peso molecular:3,256.03 g/molH-VSFLSALEEYTK^-OH
Peptide H-VSFLSALEEYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DATNVGDEGGFAPNILENK^-OH
Peptide H-DATNVGDEGGFAPNILENK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLEEQIAK^V-OH
Peptide H-HLEEQIAK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFIEDLLFNK^-OH
Peptide H-SFIEDLLFNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLAPYAQDTQEK^-OH
Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLGGSQQLLHNK^-OH
Peptide H-HLGGSQQLLHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-HWSYGLRPG-NH2
Peptide pE-HWSYGLRPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GRKKRRQRRRPP-NH2
Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HMTEVVR^RC-OH
Peptide H-HMTEVVR^RC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.26Rfa, Hypothalamic Peptide, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C127H195N37O37Peso molecular:2,832.17 g/molH-AFALWSAVTPLTFTR^-OH
Peptide H-AFALWSAVTPLTFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-IQKEIDRLNEVAKNLNESLI-OH
Peptide LCBiot-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-GYG-OH
Peptide Ac-GYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^YIHPFHL-OH
Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATVVYQ^GER-OH
Peptide H-ATVVYQ^GER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Annexin A1(1-25)(dephosphorylated)(human)ammonium salt
CAS:Annexin A1 is a phospholipid-binding protein that is involved in the regulation of inflammation. It is often found in atherosclerotic lesions and has been shown to be an anti-inflammatory cytokine. Annexin A1 (dephosphorylated) does not inhibit the activity of enzymes such as cyclooxygenase and lipoxygenase, and so it may have therapeutic potential for treatment of autoimmune diseases such as Crohn's disease or bowel disease. Annexin A1 also has anti-inflammatory properties, which may be due to its ability to inhibit the production of proinflammatory cytokines such as IL-6 and TNF-α by inhibiting the activation of NFκB.Fórmula:C141H210N32O44S·NH4Pureza:Min. 97 Area-%Forma y color:White PowderPeso molecular:3,107.47 g/molFor-MAIVGTIIKIIKAIIDIFAK-OH
Peptide For-MAIVGTIIKIIKAIIDIFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KRFKQDGGWSHWSPWSSC-NH2
Peptide Ac-KRFKQDGGWSHWSPWSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Delicious peptide (bovine) trifluoroacetate
CAS:Delicious peptide (bovine) trifluoroacetate is a polymerase chain reaction probe that is complementary to the 3' end of the human insulin gene. When used in a polymerase chain reaction, it amplifies the DNA sequences at the 3' end of the gene. The product of this amplification has been shown to inhibit genetic disorders such as metabolic disorders, iron homeostasis, and leukemia. This agent also inhibits acidic fibroblast proliferation and pluripotent cells. This drug has been shown to have a molecular docking analysis with pharmacological agents and may be helpful in treatments for various diseases.Fórmula:C34H57N9O16•(C2HF3O2)xPureza:Min. 95 Area-%Forma y color:PowderPeso molecular:847.87 g/molH-YYQQLK^-OH
Peptide H-YYQQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQVYSR^-OH
Peptide H-IQVYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSLFFFPLPLLIK^-OH
Peptide H-GSLFFFPLPLLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLANVSTVLTSK^-OH
Peptide H-FLANVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH
Peptide H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-Gln-Gly-Arg-AMC·HCl
CAS:Boc-Gln-Gly-Arg-AMC·HCl is a reagent that is used as a reaction component in the synthesis of peptides, antibiotics, and other complex compounds. Boc-Gln-Gly-Arg-AMC·HCl is also a useful scaffold for the synthesis of new fine chemicals. This chemical has a CAS number of 133448-21-2, and is classified as a speciality chemical and versatile building block. It can be used to synthesize various fine chemicals with high purity and quality.Fórmula:C28H40N8O8·HClPureza:Min. 95%Forma y color:PowderPeso molecular:653.13 g/molH-GFYPSDIAVEWESNGQPENNYK^-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (Rat)
Nesfatin-1 is a peptide hormone that is encoded by the NPY gene. It is found in the hypothalamus and pancreas, where it regulates appetite. Nesfatin-1 has been shown to reduce food intake in rats by activating the hypothalamic feeding center and suppressing the appetite center. It also stimulates glucose production in pancreatic beta cells and increases insulin release from pancreatic alpha cells. Nesfatin-1 (Rat) is a peptide hormone that is encoded by the NPY gene. It is found in the hypothalamus and pancreas, where it regulates appetite. Nesfatin-1 has been shown to reduce food intake in rats by activating the hypothalamic feeding center and suppressing the appetite center. It also stimulates glucose production in pancreatic beta cells and increases insulin release from pancreatic alpha cells.Fórmula:C424H684N116O136Pureza:Min. 95%Peso molecular:9,582.88 g/molFluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tertiapin-Q trifluoroacetate salt
CAS:A peptide found in honey bee venom; Potassium channel inhibitorFórmula:C106H175N35O24S4Pureza:Min. 95%Peso molecular:2,452.01 g/molAc-AGFAGDDAP-NH2
Peptide Ac-AGFAGDDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPVALGLK^-OH
Peptide H-IPVALGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Ala-Arg-AMC hydrochloride
CAS:H-Ala-Arg-AMC hydrochloride is a reagent that can be used in the synthesis of various complex compounds. This reagent is a useful scaffold for high quality research chemicals. It is also a versatile building block, which can be used as an intermediate or a building block. H-Ala-Arg-AMC hydrochloride is easily soluble in organic solvents and has a CAS number of 83363-71-7.Fórmula:C19H26N6O4·HClPureza:Min. 95 Area-%Forma y color:PowderPeso molecular:438.91 g/molH-SGTDVDAANL^R^-OH
Peptide H-SGTDVDAANL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Val-Glu-Ile-Asp-AMC
CAS:Ac-Val-Glu-Ile-Asp-AMC is a cell death inducer that is used to study the mechanisms of apoptosis. It has been shown to cause neuronal death in culture and also to inhibit the growth of cultured cells by inducing the activation of caspase-9, which causes protease activity. Ac-Val-Glu-Ile-Asp-AMC has been shown to induce heart function in vivo, as well as to stimulate mitochondrial membrane potential and mitochondrial cytochrome c release. This compound also induces autophagy in vitro and can affect fatty acid metabolism.Fórmula:C32H43N5O11Pureza:Min. 93 Area-%Forma y color:PowderPeso molecular:673.71 g/mol


