Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29598 productos de "Péptidos"
Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Fórmula:C54H103NO7SPureza:Min. 95%Peso molecular:910.46 g/molRef: 3D-FP107899
Producto descatalogadobeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Producto descatalogadoMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C74H128N16O18Peso molecular:1,529.95 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Fórmula:C216H371N75O59S6Peso molecular:5,155.22 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Fórmula:C110H178N26O31SPeso molecular:2,392.86 g/molRef: 3D-VAC-00589
Producto descatalogadoFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Fórmula:C41H59N11O9Peso molecular:850.00 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Fórmula:C35H56N8O9SPeso molecular:765 g/molRef: 3D-VAC-00317
Producto descatalogadoRef: 3D-VAC-00670
Producto descatalogado[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C33H47N9O8SPeso molecular:729.86 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Fórmula:C116H190N32O35SPeso molecular:2,625 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Fórmula:C131H211N43O38Peso molecular:2,996.41 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Fórmula:C64H100N18O14Peso molecular:1,345.62 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Fórmula:C67H87N15O14Peso molecular:1,326.53 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C41H43FN4O14Pureza:Min. 95%Peso molecular:834.8 g/molRef: 3D-FF111115
Producto descatalogadogp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Fórmula:C135H221N45O33Peso molecular:3,002.55 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Fórmula:C104H159N29O31Peso molecular:2,311.60 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Fórmula:C143H226N38O39SPeso molecular:3,133.71 g/molbeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Fórmula:C86H151N31O26S2Peso molecular:2,099.48 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Fórmula:C22H26N4O6Peso molecular:442.48 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Fórmula:C23H28N4O4Peso molecular:424.50 g/molBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Fórmula:C94H159N31O20S2Peso molecular:2,139.48 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Fórmula:C197H317N59O54S3Peso molecular:4,472.26 g/molProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Fórmula:C153H259N49O52Peso molecular:3,616.98 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Fórmula:C73H117N19O19Peso molecular:1,564.86 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Fórmula:C184H282N56O53S2Peso molecular:4,190.77 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Fórmula:C90H136N22O28S2Peso molecular:2,038.34 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-BC183139
Producto descatalogadobeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Fórmula:C28H45N7O9Peso molecular:623.71 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Fórmula:C171H254N4O16Peso molecular:3,870.52 g/molAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Fórmula:C71H119N25O25SPureza:Min. 95%Peso molecular:1,754.92 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Fórmula:C50H65N11O11S2Peso molecular:1,060.29 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Fórmula:C27H36N8O5Pureza:Min. 95%Peso molecular:552.6 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Fórmula:C63H103N25O19Peso molecular:1,514.68 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Producto descatalogadoZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C36H39F3N6O13SPureza:Min. 95%Peso molecular:852.79 g/molRef: 3D-FA110597
Producto descatalogadoZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C23H24N4O6•C2HF3O2Pureza:Min. 95%Peso molecular:566.48 g/molRef: 3D-FG111473
Producto descatalogado[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Fórmula:C49H81N21O17Peso molecular:1,236.32 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Fórmula:C40H72N12O13Peso molecular:929.09 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Fórmula:C133H204N34O37SPeso molecular:2,903.38 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Fórmula:C262H403N79O76S3Peso molecular:5,971.67 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C23H33N5O9Peso molecular:523.55 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Fórmula:C116H161N27O32S4Peso molecular:2,573.99 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Fórmula:C145H238N48O38S2Peso molecular:3,325.86 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Fórmula:C147H227N39O43SPeso molecular:3,260.75 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Fórmula:C194H318N62O62SPeso molecular:4,543.14 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Fórmula:C167H258N46O48SPeso molecular:3,710.26 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Fórmula:C25H37N5O7Peso molecular:519.6 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Fórmula:C157H261N49O43S6Peso molecular:3,715.47 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Fórmula:C217H322N58O60SPeso molecular:4,767.47 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Fórmula:C33H45N6O12PPeso molecular:748.8 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Fórmula:C61H94N18O16Peso molecular:1,335.5 g/molBiotin-Gastrin Releasing Peptide, human
Catalogue peptide; min. 95% purity
Fórmula:C140H218N40O33S3Peso molecular:3,085.74 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Fórmula:C33H44N10O7•(HCl)xPureza:Min. 95%Peso molecular:692.77 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C33H36N2O9Pureza:Min. 95%Peso molecular:604.65 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Fórmula:C60H105N21O12Peso molecular:1,312.64 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111727
Producto descatalogadoH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/molRef: 3D-FS108741
Producto descatalogadoNps-Val-OH·DCHA
CAS:Producto controladoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molRef: 3D-FN107891
Producto descatalogado(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C57H72N14O8Pureza:Min. 95%Peso molecular:1,081.27 g/molRef: 3D-FD108769
Producto descatalogadoDesmopressin
CAS:Producto controladoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Fórmula:C46H64N14O12S2Pureza:Min. 95%Forma y color:PowderPeso molecular:1,069.22 g/molH-His-Arg-OH
CAS:H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Producto descatalogadoDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Fórmula:C35H60N12O7Peso molecular:760.94 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C50H63N15O13Pureza:Min. 95%Peso molecular:1,082.13 g/molRef: 3D-FA110993
Producto descatalogadoN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C20H32N4O4Pureza:Min. 95%Forma y color:PowderPeso molecular:392.49 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Producto controladoPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C14H24N2O6·C12H23NPureza:Min. 95%Peso molecular:497.67 g/molRef: 3D-FA107927
Producto descatalogadoGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Fórmula:C70H107N19O19SPureza:Min. 95%Peso molecular:1,550.78 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogadoH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H14N2O3Pureza:Min. 90%Forma y color:PowderPeso molecular:174.2 g/molRef: 3D-FA107958
Producto descatalogadoH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Forma y color:PowderPeso molecular:204.18 g/molRef: 3D-FA107994
Producto descatalogadoDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Fórmula:C27H48N8O7S3Pureza:Min 95%Peso molecular:692.92 g/mol[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Fórmula:C40H65N13O7Peso molecular:840.05 g/molRef: 3D-VAC-00688
Producto descatalogadoAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Fórmula:C50H72N13O15PPeso molecular:1,126.20 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C53H80N20O18Pureza:Min. 95%Peso molecular:1,285.3 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C45H47FN6O14Pureza:Min. 95%Peso molecular:914.89 g/molMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS:This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.
Fórmula:C28H36N6O10Pureza:Min. 95%Peso molecular:616.6 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
