Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29610 productos de "Péptidos"
H-FMDVYQR^-OH
Peptide H-FMDVYQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH
Peptide H-DTHFPICIFCCGCCHRSK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Val-Ile-Gly
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C13H25N3O4Peso molecular:287.36 g/molH-SGGVVK^-OH
Peptide H-SGGVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gomesin (AgGom)
Gomesin is a peptide derived from the venom of the tarantula Acanthoscurria gomesiana. It has been shown to have antimicrobial and anti-cancer properties. Gomesin has been shown to be effective against Acanthoscurria gomesiana, a spider that can cause skin lesions in humans. In vitro studies have shown that Gomesin inhibits the growth of melanoma cells and reduces their invasiveness. Studies on mice have also demonstrated its potential for treating cancer. Gomesin belongs to a class of peptides called "Biologically Active Peptides" that are known for their ability to stimulate cellular responses in animal models and human subjects.
Fórmula:C93H152N26O23S4Pureza:Min. 95%Peso molecular:2,130.62 g/molH-IQSFLGGAPTEDLK^-OH
Peptide H-IQSFLGGAPTEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans
CAS:Producto controladoDabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.Fórmula:C90H120N22O16SPureza:Min. 95%Peso molecular:1,798.16 g/molPAR-3 (1-6) amide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H46N10O7Peso molecular:646.75 g/molH-GTFIIDPGGVIR^-OH
Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formyl-MLF-[Cys(AF488)]
Formyl-MLF-[Cys(AF488)] is composed of the chemotactic peptide: N-formyl-methionine-leucine-phenylalanine. N-formyl-methionine is the N-terminal amino acid present on bacteria and allows the bacteria to interact with phagocytic cells such as macrophages and monocyte-derived dendritic cells through surface formyl-MLF receptors. As a result Formyl-MLF labelled with the fluorescent dye, Alexa Fluor 488 can be used as a marker of bacterial infections. It has also been demonstrated that the use of multiple formyl-MLF moieties can target polymeric drug delivery molecules to phagocytic cells. In addition to Alexa Fluor 488's application in marking bacterial infections, its properties of being photo-bleaching resistant and having a high quantum yield allow it to carry out its most common use in the visualisation and location of dendritic structures and synapses.Peso molecular:1,237.3 g/molCyclo(-D-Leu-D-Pro)
CAS:Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.Fórmula:C11H18N2O2Pureza:Min. 95%Forma y color:PowderPeso molecular:210.27 g/molSARS-CoV-2 NSP13 (231-245)
The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (231-245) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
Peso molecular:1,618.8 g/mol[5-FAM]-(KFF)3K
(KFF)3K is a cationic cell penetrating peptide which can be conjugated to PNA oligomers to aid in their penetration of the bacterial cell wall to function as anti-microbials. It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.Peso molecular:1,769.9 g/molInsulin (Human)
CAS:Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.
Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.Fórmula:C257H383N65O77S6Pureza:Min. 95%Peso molecular:5,807.6 g/molAD01 N-terminal Q
AD01 is a derivative of the FK506 binding protein-like (FKBPL), and exerts potent anti-angiogenic activity in vitro and in vivo to control tumour growth.Recent studies have shown that AD-01 inhibits Rac-1 activity, and up-regulates RhoA and the actin binding proteins, profilin and vinculin.In this way, the anti-angiogenic proteins, FKBPL, and AD-01, offer a promising and alternative approach for targeting both CD44 positive tumours and vasculature networks. Recent clinical studies have shown that AD01 and other FKBPL-based peptides may offer an alternative for targeting treatment-resistant breast cancer stem cells.Peso molecular:2,702.4 g/molH-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Temporin A
Temporin A is a short, linear, basic and highly hydrophobic anti-microbial peptide (AMP) isolated from the frog, Rana temporaria. Temporin A is particularly active against Gram-positive bacteria including those arranged in biofilms. Temporin A is also active against some Gram-negative bacteria and Leishmania parasites.Temporin A adopts an alpha-helical conformation in a membrane-mimicking environment and is able to perturb the membrane of microbial cells. Temporin A is practically non-haemolytic up to concentrations five-times higher than their minimum inhibitory concentration (MIC) against Gram-positive bacteria.Peso molecular:1,396.76 g/molAc-RKRR-NH2
Peptide Ac-RKRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Click Arg9
Cell penetrating peptides (CPP) are a keen area of molecule design to create the ideal vector for transporting macromolecule cargo into the cell. There is also a crossover of CPP acting as antimicrobial peptides (AMP) due to their ability to permeabilise the lipid membrane. AMPs are now being considered as a tool against the rise of antibiotic-resistant bacteria. CPPs and AMPS tend to be 10 - 30 amino acids long, cationic, and rich in arginine (R) and tryptophan (W). The presence of R and W in the backbone have been used to generate de novo CPP/AMP peptides with improved functions. Of these, nonarginine (R9) was shown to have the highest cellular uptake against other CPPs tested, lowest cytotoxicity and significant antimicrobial activity.R9 is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-R9 allows a wide variety of applications and has already been used for conjugation, modification and peptide design.
Forma y color:PowderPeso molecular:1,502 g/molGalactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)
CAS:Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.
Fórmula:C34H52N10O12Pureza:Min. 95%Peso molecular:792.85 g/molSARS-CoV-2 NSP13 (326-340)
The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (326-340) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Peso molecular:1,694 g/molSuc-KRRK-NH2
Peptide Suc-KRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VHITSLLPTPEDNLEIVLHR^-OH
Peptide H-VHITSLLPTPEDNLEIVLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Anoplin
Antimicrobial and cytolytic peptide isolated from the venom of the spider wasp Anoplius samariensis. Anoplin has potent and board-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria, antifungal properties against some plant pathogenic fungi, and no haemolytic activity against human erythrocytes. At 10 amino acids long, anoplin is the smallest naturally occurring antimicrobial and cytolytic peptide, its small size may have advantages for chemical manipulation and medical application.Peso molecular:1,153.5 g/molLys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C41H75N11O11Peso molecular:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVAVSQVAR^-OH
Peptide H-SVAVSQVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Azhx-Penetratin
Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. This penetratin has been synthesised with an N-terminal 6-azidohexanoic acid (Azhx) which can be used for various applications as a linker.Forma y color:PowderPeso molecular:2,384.4 g/molGM CSF Human
GM CSF Human is a protein that belongs to the GM-CSF family. GM-CSF proteins are cytokines that activate neutrophils and macrophages, which play an important role in the immune system. This protein is a potent activator of receptor and peptides, as well as ion channels. It has been shown to inhibit ligand binding to receptors and inhibit the function of antibodies. The antibody can be used as a research tool for Cell Biology or to study the effects of drugs on ion channels. The CAS number for this protein is 57722-07-1.Pureza:Min. 95%H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH
CAS:H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.Fórmula:C39H63N11O10Pureza:Min. 95%Peso molecular:845.99 g/molTertiapin-Q trifluoroacetate salt
CAS:A peptide found in honey bee venom; Potassium channel inhibitorFórmula:C106H175N35O24S4Pureza:Min. 95%Peso molecular:2,452.01 g/molHCTU Reagent
CAS:HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.Fórmula:C11H15N5OClPF6Pureza:Min. 98.0 Area-%Peso molecular:413.69 g/molAc-AGFAGDDAP-NH2
Peptide Ac-AGFAGDDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-I^DAL^NENK-OH
Peptide H-I^DAL^NENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLEGSDDAVLLQR^-OH
Peptide H-SLEGSDDAVLLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Skeletal muscle-targeted peptide MSP
Gene therapy is potentially an ideal treatment for muscle tissue myopathies but targeting remains an issue. The large volume of muscle in the body versus the requirement for tissue-specificity is of particular concern. This heptapeptide has been shown to preferentially bind skeletal myofibers and thus can be used to study targeting of peptide/gene-delivery to muscle tissue. Research into gene therapy of Duchenne muscular dystrophy (DMD) and spinal muscular atrophy (SMA) has been of particular interest with muscle targeting peptides. This product already shows ideal placement to continue that research to overcome some of these issues.Peso molecular:674.4 g/molα-Neo-Endorphin, porcine
Peptide α-Neo-Endorphin, porcine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C60H89N15O13Peso molecular:1,228.47 g/molH-VVVGAGGVGK^-OH
Peptide H-VVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFórmula:C192H295N61O60SPureza:Min. 95%Peso molecular:4,449.93 g/molH-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,771 g/molL17E
CAS:L17E is an endosomolytic peptide derived from the cationic and membrane-lytic spider venom peptide M-lycotoxin and contains a substitution of leucine by glutamic acid at position 17. L17E is able to promote the endocytic uptake and cytosolic delivery of exosome-encapsulated proteins.A major obstacles to intracellular targeting by antibodies is the limited release of the antibodies into the cytosol, once inside endosomes. L17E can achieve an enhanced cellular uptake via the induction of micropinocytosis. Once inside the endosome, positively charged L17E is able to preferentially disrupt negatively charged endosomal membranes to enable a marked cytosolic liberation of antibodies (immunoglobulins G (IgGs)) from endosomes.L17E had little pH dependence and no enhanced helical structure is needed for L17E-mediated membrane lysis.Fórmula:C134H219N37O32Forma y color:PowderPeso molecular:2,857.7 g/molCompstatin
The cyclic tridecapeptide Compstatin, binds to and selectively inhibits the interaction between C3 and convertase, hence preventing the formation of C3a and C3b and activation of the complement system. Compstatin has the ability to form β-turns and hydrophobic clusters which are crucial for its inhibitory properties. When binding between C3 MG4 and MG5 domains, located within the MG-ring of the β-chain, Compstatin undergos a conformational change which is believed to prevent C3 from binding to C3 convertase through steric hindrance. Consequently the complement cascade is inhibited.The complement cascade is an important feature of the immune system. C3b, produced from the interaction of C3 and C3 convertase, binds to pathogens and somatic cells and signals for their removal from the body. However the increased activation of the complement system can result in diseases, associated with Alzheimers, strokes, heart attacks and autoimmune diseases. Therefore Compstatin can be used as a therapeutic agent within medicine.Forma y color:PowderPeso molecular:1,549.7 g/molH-ELINNELSHFLEEIK^-OH
Peptide H-ELINNELSHFLEEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDYDLNAVR^-OH
Peptide H-GDYDLNAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPVALGLK^-OH
Peptide H-IPVALGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuropeptide S human
Neuropeptide S (NPS) is a neuropeptide found in mammalian brains, primarily in neurons in the lateral parabrachial nucleus, the peri-locus coeruleus and the principle sensory 5 nucleus of the trigeminus. NPS in involved in several neuroendocrine, behavioural and inflammatory responses, including: reducing anxiety in mice- suppressing appetite and inducing wakefulness and hyperactivity. NPS treatment can be used to improve fear extinction in mice and limit fear memory retrieval after fear reduction training, thus making it an interesting target for treatment of post-traumatic stress disorder. NPS exerts its actions by binding to a G-protein coupled receptor, NPSR.Peso molecular:2,186.1 g/molFmoc-11-aminoundecanoic acid
CAS:Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.
Fórmula:C26H33NO4Pureza:Min. 98.0 Area-%Peso molecular:423.56 g/molsurvivin (baculoviral IAP repeat-containing protein 5) (21-28)
Survivin is an intracellular tumour-associated antigen that is part of the inhibitor of apoptosis (IAP) family. Survivin expression increases as cells age but becomes over-expressed in cancer cells. Expression is also important during embryonic development and tissue regeneration. With roles in aging, apoptosis, and cancer, there is considerable interest in understanding the function of Survivin. Survivin expression is regulated by TGF-β and increased following intestinal inflammation during the healing process.The high expression of Survivin in cancer cells has led to the search for a vaccine that induces epitope-specific CD8+ T cells. The epitope TFKNWPFL restricted to H-2 Db was identified using prediction algorithms and MHC class I binding assays. The epitope was delivered to mice by intradermal electroporation (EP). The Survivin epitope induced a CD8+ cytotoxic T lymphocyte (CTL) response as shown by IFN-staining- they also showed an activated effector phenotype as CD44 and CD107 were upregulated. The Survivin vaccine was able to confer protection against melanoma in mice and suppress angiogenesis. This Survivin epitope could be a vital step in creating a human vaccine that generates CD8 CTLs with specific functional cytotoxic activity against tumour cells.The sequence provided here aligns to residues 21-28 of the Survivin epitope, the initial residue of the epitope has been omitted as it is not conserved between mice and human sequences.Peso molecular:1,051.5 g/molH-AFVFPK^-OH
Peptide H-AFVFPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-His(Trt)-OH
CAS:Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum. Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and reFórmula:C40H33N3O4Pureza:Min. 95%Peso molecular:619.73 g/molTertiapin Q
CAS:Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.
Fórmula:C106H175N35O24S4Pureza:Min. 95%Peso molecular:2,452.05 g/molHIV - 1 MN ENV - 14
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,622.7 g/molH-LYTLVLTDPDAPSR^-OH
Peptide H-LYTLVLTDPDAPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Nucleoprotein (353-370)
The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (353-370) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Peso molecular:2,111.1 g/molGLP-1 (1-37)
CAS:Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.Peso molecular:4,169.54 g/molMOG 8 - 21
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,486.7 g/molSpinorphin, Bovine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C45H64N8O10Peso molecular:877.04 g/molH-GGLPLEEVTVAEVLAAR^-OH
Peptide H-GGLPLEEVTVAEVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hyp-Gly dipeptide
A hydroxyproline glycine peptide in acid form. This peptide is a substrate for prolyl dipeptidase. Ingestion of the Hyp-Gly dipeptide can improve skin conditions. Hyp-Gly ingestion improves facial skin moisture and elasticity and reduces facial aging. Additionally, Hyp-Gly enhances fibroblast proliferation.Peso molecular:188.1 g/molGhrelin Rat, Mouse
Ghrelin is involved in several physiological processes, including feeding and lipid accumulation, stress response, anxiety, cardiac performance, immunity and inflammation, taste sensation, reward-seeking behaviour, regulation of glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin is a peptide hormone that typically has a serine at the third residue and relies on modification with a fatty acid to give ghrelin its functional activity. In its modified form, ghrelin is an endogenous ligand for the pituitary gland's growth hormone receptor (GHS-R) and stimulates growth hormone release. Rat/mouse ghrelin differs from the human form at positions 11 and 12 (RV) in rats to (KA) in humans.Ghrelin acts on the hypothalamic arcuate nucleus as an orexigenic agent to stimulate appetite. Ghrelin is produced in the stomach as a precursor peptide preproghrelin, cleaved to ghrelin. Ghrelin circulates in the blood and can cross the blood-brain barrier. Levels of ghrelin respond to fasting conditions and allow signals about the energy status to be transmitted from the peripheral organs to the central nervous system to maintain energy homeostasis.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.Forma y color:PowderPeso molecular:3,314.8 g/molTransportan
Transportan is an amphipathic 27 amino acid peptide that was generated from 12 functional amino acids of galanin and 14 amino acids of mastoparan connected via a lysine residue. Transportan has been functionally characterised as a cell penetrating peptide (CPP) that does not appear to be mediated by endocytosis. All cell types tested were permeated by transportan, initially localising to the outer membrane it then travels to cytoplasmic membrane structures and eventually perfuses to the nucleoli. This CPP has been used for numerous applications and assays to great effect including indirect immunofluorescence and drug delivery.TP reveals some characteristic features of both galanin and mastoparan since it inhibits the binding of galanin to GALR-1 receptor as well as modulates the activity of G proteins due to the inhibition of GTPase activity.Forma y color:PowderPeso molecular:2,180.4 g/mol[5-FAM]-(RFR)4XB
(RXR)4XB is a cationic membrane-penetrating peptide and is effective in delivering phosphorodiamidate morpholino oligonucleotides (PMOs) into eukaryotic cells such as Escherichia coli. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.Peso molecular:2,396.3 g/molH-LSPIYNLVPVK^-OH
Peptide H-LSPIYNLVPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MART-1 (26-35)
CAS:Native Melan-A (26-35) decapeptide derives from the melanocyte lineage-specific protein Melan-A/MART-1, which is expressed in almost 75-100% of primary and metastatic melanomas. The region 26-35 of Melan-A protein acts as an antigenic peptide that is recognized by CD8+ tumor-reactive cytolytic T lymphocytes (CTLs) for designing antigen-specific cancer vaccines1. It has been shown that CD8+ Melan-A-specific CTLs isolated from melanoma patients efficiently lyse the Melan-A-expressing HLA-A*0201+ melanoma cell line. However, CTLs preferentially recognize the Melan-A (26-35) peptide as compared with the Melan-A (27-35) peptide. Moreover, the Melan-A (26-35) A27L analog (ELAGIGILTV) has a higher binding affinity to HLA-A*0201 than the native Melan-A (26-35) peptide (EAAGIGILTV), and consequently displays more potent antigenicity and immunogenicity. It has been reported that the concentration of Melan-A (26-35) A27L analog required to obtain 50% of maximal antigenic activity (EC50) is 0.01nM, whereas that of the native Melan-A (26-35) peptide is 0.25nM1. Therefore, the relative activity of Melan-A (26-35) A27L analog is 25 fold higher than that of the native Melan-A (26-35) peptide. Furthermore, functional competition assay has shown that the concentration of Melan-A (26-35) A27L analog required to achieve 50% inhibition (IC50) of tumor lysis is 2nM, which is 10 fold lower than that of the native Melan-A (26-35) peptide. Regarding peptide stability in human serum, the half-lifes (t1/2) of the native Melan-A (26-35) peptide and the A27L analog are quite similar (45 and 40min, respectively) as measured by HPLC-ESI-MS, but much higher than that of the Melan-A (27-35) nonapeptide (5min).Fórmula:C42H74N10O14Forma y color:PowderPeso molecular:943.1 g/molTBTU Reagent
CAS:TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).Fórmula:C11H16N5OBF4Pureza:Min. 95%Peso molecular:321.08 g/molNeuroendocrine Regulatory Peptide-1 (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C113H192N36O39Peso molecular:2,678.99 g/molH-HHHHHHC-NH2
Peptide H-HHHHHHC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 88 (FFFDIDLLLQRGPQY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,872.2 g/molH-VHLTP^EEKSAVTAL-OH
Peptide H-VHLTP^EEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-Furoyl-LIGRLO-amide acetate salt
CAS:2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.Fórmula:C36H63N11O8Pureza:Min. 95%Peso molecular:777.96 g/molH-AQAASLEAEHQAIIR^-OH
Peptide H-AQAASLEAEHQAIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 05
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,694.1 g/molH-LHDFRHQIL^-OH
Peptide H-LHDFRHQIL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-9/aa33 - 47
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,827.1 g/molH-GPTGTGESKC-NH2
Peptide H-GPTGTGESKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSGEYIPTV^-OH
Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,800.1 g/molH-SILKV-NH2
Peptide H-SILKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Ser(tBu)-Wang resin (200-400 mesh)
Fmoc-Ser(tBu)-Wang resin is a versatile building block that is used in the synthesis of complex compounds. It has a CAS number and is available as a fine chemical or reagent. Fmoc-Ser(tBu)-Wang resin is an intermediate for research chemicals, reaction components, and speciality chemicals. This material can be used as an important building block in the synthesis of many useful compounds and has high quality.Fórmula:C22H24NO4RPureza:Min. 95%Forma y color:PowderPeso molecular:366.43 g/molBiotin-Influenza A NP (147-155) (H-2Kd)
Influenza A nucleoprotein (NP) residues 147-155 (TYQRTRALV) is from a conserved region of the nucleoprotein that is positively selected. NP (147-155) is an effective immunodominant CTL epitope MHC allele H-2Kd in mice that can induce an effective antigen-specific immunity. This was validated by HLA binding and cytotoxicity assays in human cells. Immunisation of mice with the NP (147-155) offers protection against a fatal dosage of influenza. In addition, the NP (147-155) epitope can stimulate antigen-specific T cells in T cell assays such as ELISPOT to understand humoral responses to viral infection. Further work with the NP (147-155) epitope can help new flu vaccine design to provide more effective protection. This epitope is provided with a C-terminal biotin sequence for easier purification and detection.Peso molecular:1,332.7 g/molJAG-1, scrambled
Scrambled peptide of JAG-1(188-204). Jagged - 1 is a cell surface ligand for in the Notch pathway. Notch receptors and ligands are present on the extracellular service of cells and require cell-cell contact for engagement. Ligand binding to Notch receptors results in the proteolytic cleavage of membrane-bound Notch receptors, thus allowing the intercellular region to be transported to the nucleus and become a transcriptional activator. The ligand-induced Notch activation is regulated by E3 ubiquitin ligases, Mindbomb1 (Mib-1) and Neuralized.JAG1 is widely expressed throughout mammalian development, across many tissues and developmental stages. Notch signalling plays a critical role in cellular fate determination including muscle cell differentiation, neurogenesis, and the development of the sensory regions of the inner ear- heart- kidney- eye- lung and other tissues.Jag-1 has been implicated in breast- cervical- colorectal- endometrial- gastric- head and neck- ovarian- hepatocellular- lung- pancreatic- prostate, and kidney and adrenocortical cancers, leukemia and lymphoma. Co-overexpression of Notch-1 and Jagged-1 predicts the poorest overall cancer survival. JAG1 mutations have also been associated Alagille syndrome.Peso molecular:2,105.9 g/molPuma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Truncated flagellin 22 (flg22)
Flagellin is the structural protein which forms the major portion of bacterial flagella filaments. The N- and C- terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the most conserved stretch of amino acids across bacterial species and is located towards the N-terminal of flagellin.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.Truncated flagellin 22 (flg22-θ”2) represents amino acids 1-20 of flg22. It is a strong and selective agonist of tomato FLS2, with weak agonist activity towards Arabidopsis FLS2 even at high concentrations.Peso molecular:2,087.1 g/molBombesin
Bombesin was originally isolated from the skin of the european fire-bellied toad (Bombina bombina) and has two known homologues Neuromedin B (NMB) and gastrin-releasing peptide (GRP).Bombesin-like peptides are involved in many physiological functions including: regulation of food intake- anxiety and fear-related behaviour, thermoregulation, stress response, learning and memory and in the stimulation of smooth muscle contraction. Bombesin is also a tumour marker for small cell carcinoma in the lung, gastric cancer, pancreatic cancer, and neuroblastoma.The receptors for these two peptides are known as bombesin receptor type 1 (BB1 also known as NMB receptor) and bombesin receptor type 2 (BB2 also known as GRP receptor). Bombesin shows high affinity to both of these receptor subtypes. These bombesin-like peptides and their receptors are widely distributed in the central nervous system (CNS) and gastrointestinal (GI) tract.This peptide contains an N-terminal pyroglutamyl to prevent the intramolecular cyclisation of the N-terminal of glutamine to N-pyroglutamate (pGlu).Peso molecular:1,618.8 g/molAc-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt
CAS:Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt is a peptide that has been shown to have anti-cancer, enzyme inhibitory, and anti-inflammatory activities. The peptide is derived from the proteolytic cleavage of human collagenase. It inhibits both matrix metalloproteinases (MMPs) and stromelysin in vitro. Acetyl Proleu Gly Gly Leu Gly OEt has also been shown to inhibit cancer cells in culture by inhibiting RNA synthesis and protein synthesis.Fórmula:C31H53N5O8SPureza:Min. 95%Peso molecular:655.86 g/molRanatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H85N16O13SPeso molecular:1,281.5 g/molEC dipeptide
EC-acid has a formal charge of 0 and a range of biological and chemical uses. CE-acid is also available in our catalogue.Peso molecular:250.1 g/molHXB2 gag NO-116/aa461 - 475
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,663.8 g/molFibronectin Active Fragment (RGDS)
CAS:Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity. The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling. The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.Fórmula:C15H27N7O8Pureza:Min. 95%Peso molecular:433.42 g/molH-YGIENVK^-OH
Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSIIHIER^-OH
Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLNQELR^-OH
Peptide H-VLNQELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.Pureza:Min. 95%H-LRPVAAEVYGTER^-OH
Peptide H-LRPVAAEVYGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLYSALANK^-OH
Peptide H-QLYSALANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Flagellin 22 (flg22)
Flagellin is a structural protein which forms the major portion of bacterial flagellar filaments. The N- and C-terminals of flagellin are highly conserved regions, whereas the central core can vary greatly between bacterial species. Flagellin 22 (flg22) is the stretch of amino acids most conserved across bacterial species and is located towards the N-terminal of the flagellin protein.Flg22 is a potent elicitor of plant immune responses and is recognised in plants by the membrane bound leucine-rich repeat-receptor kinase FLAGELLIN SENSITIVE 2 (FLS2). Flg22 induces defence gene expression to trigger both local and systemic immune responses and is thus widely used in plant defence studies.Forma y color:PowderPeso molecular:2,272.48 g/mol
![Formyl-MLF-[Cys(AF488)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110384.webp&w=3840&q=75)
![[5-FAM]-(KFF)3K](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101018.webp&w=3840&q=75)
![[5-FAM]-(RFR)4XB](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101021.webp&w=3840&q=75)
