Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29707 productos de "Péptidos"
FMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Fórmula:C41H59N11O9Peso molecular:850.00 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS:Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C149H246N44O42SPureza:Min. 95%Peso molecular:3,357.88 g/molRef: 3D-FA109070
Producto descatalogadoH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/molRef: 3D-FT108183
Producto descatalogadoBTK derived peptide
Catalogue peptide; min. 95% purity
Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Fórmula:C53H84N12O16Peso molecular:1,145.33 g/molbeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Fórmula:C81H128N32O19S2Peso molecular:1,918.25 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Fórmula:C68H113N19O19Peso molecular:1,500.77 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C185H268N48O51S2Peso molecular:4,044.63 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Fórmula:C64H114N22O12Peso molecular:1,383.76 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Fórmula:C74H121N17O20SPeso molecular:1,600.9 g/mol[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C78H109N23O15SPeso molecular:1,640.95 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Fórmula:C44H66N14O10SPeso molecular:983.17 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Fórmula:C216H343N67O60Peso molecular:4,838.43 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C46H71N15O11SPeso molecular:1,042.24 g/molMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Fórmula:C101H172N30O32Peso molecular:2,318.66 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Fórmula:C145H210N42O45Peso molecular:3,261.54 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Fórmula:C107H141N22O37PS2Peso molecular:2,422.53 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Fórmula:C28H38N6O6SPeso molecular:586.72 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Fórmula:C46H68N10O14SPeso molecular:1,017.17 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C59H84N18O14Pureza:Min. 95%Peso molecular:1,269.41 g/molRef: 3D-FS109491
Producto descatalogadoCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Fórmula:C124H205N39O39S2Peso molecular:2,930.38 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Fórmula:C46H75N9O11S2Peso molecular:994.28 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Fórmula:C97H160N26O32Peso molecular:2,202.51 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Fórmula:C46H59N7O12Peso molecular:902.02 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Fórmula:C82H122N22O25SPeso molecular:1,848.08 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Fórmula:C28H36N6O6Peso molecular:552.64 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C56H85N17O13Peso molecular:1,204.41 g/molZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C23H24N4O6•C2HF3O2Pureza:Min. 95%Peso molecular:566.48 g/molRef: 3D-FG111473
Producto descatalogadoPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Fórmula:C54H103NO7SPureza:Min. 95%Peso molecular:910.46 g/molRef: 3D-FP107899
Producto descatalogadoDesmopressin
CAS:Producto controladoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Fórmula:C46H64N14O12S2Pureza:Min. 95%Forma y color:PowderPeso molecular:1,069.22 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C60H102N16O17Peso molecular:1,319.58 g/molTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Fórmula:C51H91N19O18Peso molecular:1,258.41 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C60H87N19O14Peso molecular:1,298.48 g/molTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C80H137N19O25Pureza:Min. 95%Peso molecular:1,765.06 g/molRef: 3D-FT109022
Producto descatalogadoP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Fórmula:C52H84N14O21Peso molecular:1,241.33 g/molrec IFN-gamma (human)
CAS:Producto controladoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FR108523
Producto descatalogadoMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogadoAlpha-Dendrotoxin
CAS:Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Fórmula:C305H472N98O84S6Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:7,048.02 g/molRef: 3D-FD108355
Producto descatalogado[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Fórmula:C63H98N16O23S3Peso molecular:1,543.77 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molRef: 3D-VAC-00310
Producto descatalogadoCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Fórmula:C35H41N5O12Peso molecular:723.7 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Fórmula:C65H116N16O17Peso molecular:1,393.75 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Fórmula:C42H66N12O12Peso molecular:931.06 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Fórmula:C194H296N54O57SPeso molecular:4,328.91 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H243N41O31Peso molecular:3,080.83 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Fórmula:C58H77N13O10Peso molecular:1,116.34 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Fórmula:C42H61N11O10Peso molecular:880.02 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Fórmula:C114H174N30O42SPeso molecular:2,668.90 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C35H51N9O8Peso molecular:725.85 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Fórmula:C48H86N18O16Peso molecular:1,171.33 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Fórmula:C69H122N26O22Peso molecular:1,667.90 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Fórmula:C110H178N26O31SPeso molecular:2,392.86 g/molRef: 3D-VAC-00589
Producto descatalogadoSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molNps-Val-OH·DCHA
CAS:Producto controladoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molRef: 3D-FN107891
Producto descatalogadoα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Fórmula:C47H72N14O11Peso molecular:1,009.19 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Fórmula:C151H211N37O39SPeso molecular:3,199.65 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C20H32N4O4Pureza:Min. 95%Forma y color:PowderPeso molecular:392.49 g/molbeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Fórmula:C42H66N10O15Peso molecular:951.05 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Fórmula:C33H45N6O12PPeso molecular:748.8 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Fórmula:C65H109N17O19SPeso molecular:1,464.75 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Fórmula:C74H128N16O18Peso molecular:1,529.95 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Fórmula:C131H211N43O38Peso molecular:2,996.41 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111727
Producto descatalogado[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Fórmula:C64H100N18O14Peso molecular:1,345.62 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Fórmula:C67H87N15O14Peso molecular:1,326.53 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Fórmula:C135H221N45O33Peso molecular:3,002.55 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Fórmula:C143H226N38O39SPeso molecular:3,133.71 g/molBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Fórmula:C157H252N46O44S2Peso molecular:3,552.17 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Fórmula:C107H140N22O34S2Peso molecular:2,342.56 g/molbeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Fórmula:C86H151N31O26S2Peso molecular:2,099.48 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C77H109N21O19SPeso molecular:1,664.92 g/molBoc-D-Glu-OEt·DCHA
CAS:Producto controladoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C12H21NO6·C12H23NPureza:Min. 95%Peso molecular:456.62 g/molRef: 3D-FB111281
Producto descatalogadoFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111733
Producto descatalogadoH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Forma y color:PowderPeso molecular:204.18 g/molRef: 3D-FA107994
Producto descatalogadoDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Fórmula:C27H48N8O7S3Pureza:Min 95%Peso molecular:692.92 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Fórmula:C27H36N8O5Pureza:Min. 95%Peso molecular:552.6 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Fórmula:C33H44N10O7•(HCl)xPureza:Min. 95%Peso molecular:692.77 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Fórmula:C8H4BrClK2NO4PPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:402.65 g/molRef: 3D-EB110885
Producto descatalogadoBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C16H25N3O6Pureza:Min. 95%Forma y color:SolidPeso molecular:355.39 g/molRef: 3D-FB111250
Producto descatalogadoAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C53H80N20O18Pureza:Min. 95%Peso molecular:1,285.3 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C33H47N9O8SPeso molecular:729.86 g/molAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Fórmula:C50H72N13O15PPeso molecular:1,126.20 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C45H47FN6O14Pureza:Min. 95%Peso molecular:914.89 g/molH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H14N2O3Pureza:Min. 90%Forma y color:PowderPeso molecular:174.2 g/molRef: 3D-FA107958
Producto descatalogadoZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molRef: 3D-FI111570
Producto descatalogadoRef: 3D-VAC-00670
Producto descatalogadoAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Met5,Arg6,7,Val8,Gly9] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00877.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
