Péptidos

TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).

<p>Boc-D-Phe-OH is an antimicrobial peptide that is a small molecule with a molecular weight of 254.8. It has been shown to have anti-tumor activity, and can be used as an alternative to conventional chemotherapeutic drugs in the treatment of cancer. Boc-D-Phe-OH binds to the hydrophobic region on the surface of cells and disrupts the cell's membrane, causing cell death by apoptosis. This peptide also shows antibacterial activity against gramicidin S, which is a Gram-positive antibiotic that belongs to the polymyxins class. The antibacterial activity of this peptide may be due to its ability to bind to divalent cations such as calcium ions and magnesium ions. Boc-D-Phe-OH has been synthesized using a method that is both efficient and rapid (less than 12 hours). It has also been shown that this peptide does not show any</p>

<p>Ac-Leu-Glu-His-Asp-H (aldehyde) is a research tool that is used in the study of ion channels and receptor proteins. It can be used to activate a receptor or ligand, or to inhibit them. Ac-Leu-Glu-His-Asp-H (aldehyde) can also be used as an antibody to identify peptides and proteins. This product has high purity and is intended for use in pharmacology and life science research.</p>

Endothelin-1 (ET-1) is a peptide hormone that stimulates the release of catecholamines from the adrenal medulla, and acts as a vasoconstrictor. ET-1 is a potent activator of endothelin receptor type A (ETA), which causes vasoconstriction and bronchoconstriction. The antibody recognizes human ET-1 and does not cross react with other endothelin peptides. This antibody can be used for the detection of ET-1 in tissues or cell culture supernatants. It can also be used to purify recombinant human endothelin or ET receptor subtypes.

<p>Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.</p>

<p>Lactacystin is a peptide that acts as an activator of ion channels. It binds to the receptor and activates the ligand-gated ion channel, which then opens the ion channel. This leads to increased influx of ions into the cell and an increase in intracellular calcium concentration. Lactacystin has been used as a research tool for studies on protein interactions, such as antibody-antigen interactions and receptor-ligand interactions. Lactacystin is also used for pharmacological purposes, such as for pain relief or for treatment of epilepsy.</p>

CART is a peptide that acts as an activator for the CART receptor. It has been shown to be a ligand for the CART receptor and blocks calcium channels in cell culture. It is a potent inhibitor of ion channels, which are proteins that allow ions to pass through the membrane of cells. CART is also used as a research tool in cell biology, pharmacology, and life science.

<p>Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.</p>

<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Beta-2 Microglobulin Human is a research tool that can be used to study the activation of receptors, ion channels, and protein interactions. It is a ligand that binds to cell surface receptors. It is also an inhibitor that blocks the formation of antibodies by binding to human immunoglobulin G (IgG) and prevents it from binding to antigens. Beta-2 Microglobulin Human is a high purity protein with a CAS number of 1768-01-7.

<p>Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

In this special TentaGel resin, the PEG spacer is attached to the polystyrene/DVB matrix by a cleavable linkage. Therefore, the PEGylated compound can easily be cleaved and separated from the insoluble support. This can be achieved with either 10 mL/g of TFA/thioanisole (95:5) for 12 hours at room temperature, or with 10 mL/g of TFA/trimethylsilyl bromide/thioanisole (94:1:5) for 1 hour at room temperature. TentaGel is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. Even less soluble peptides may be completely solubilized with this linker. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. (90 µm) 0.2-0.25 meq/g Product Application: Using this resin, cleavage yields the POE-peptide conjugates.

Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Pro-Arg-Thr-Lys-Acc-NH2 is a peptide that is used as a substrate for enzymes. This product is a specific substrate of tryptase, which is an enzyme that cleaves proteins in the pancreas. The rate of hydrolysis of Ac-Pro-Arg-Thr-Lys-Acc-NH2 by tryptase is affected by pH and temperature. The kinetic constants at 25°C are Km = 0.096 mM and Vmax = 1.073 μM/min.

SUAM-14746 is a peptide that inhibits the interactions between proteins. It has been shown to be an activator of the receptor for nerve growth factor, and it may also inhibit the activity of ion channels. SUAM-14746 is a research tool for studying protein interactions and antibody binding. It is a high purity product with CAS number 126898-09-7.

<p>Abz-Gly-Phe(NO2)-Pro-OH is a peptide that has been shown to have antihypertensive activity. It also has radical scavenging properties, and it can be used as an amino acid composition marker. Abz-Gly-Phe(NO2)-Pro-OH has been shown to inhibit the growth of faecalis and subtilis, which are both Gram positive bacteria. The peptide has also been shown to have inhibitory properties against proteolytic enzymes from bovine casein, human serum and rat blood pressure.</p>

Unsubstituted Resins for Solid Phase Synthesis

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

C-peptide is a peptide hormone that is cleaved from proinsulin in the pancreatic beta cells. Both C-peptide and insulin are released by the beta cells in the event of glycaemia. Due to it having a relatively long half life, compared to insulin, and the fact it is not immediately metabolised by the liver, makes C-peptide a useful biomarker to monitor beta cell function. Increased levels of C-peptide occurring in patients with insulin resistant type 2 diabetes mellitus, have been associated with macrovascular complications and cardiovascular morbidity. During in vitro studies it has also been found that C-peptide prevents endothelial cell reactive oxygen species from being formed and therefore oxidative stress is reduced. This also may lead to anti-inflammatory and anti-apoptotic responses.

Peptide H-K^AFSPEVIPMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Antimicrobial peptide consisting of disulfide bonds between Cys2-Cys30, Cys4-Cys19, and Cys9-Cys29. Alpha-defensin-4 is a small, cationic peptide that is part of the alpha-defensin family of antimicrobial peptides in humans. It is primarily produced by neutrophils, which are a type of white blood cell that plays a critical role in the immune response to bacterial infections.<br>Alpha-defensin-4 is known to have broad-spectrum antimicrobial activity against a wide range of bacterial pathogens, including both Gram-positive and Gram-negative bacteria. Like other alpha-defensins, alpha-defensin-4 achieves its antimicrobial activity by disrupting the cell membranes of the pathogens, leading to cell lysis and death.<br>In addition to its antimicrobial activity, alpha-defensin-4 has been found to have other functions in the body, including modulating the immune response and promoting tissue repair. It has also been implicated in the pathogenesis of certain inflammatory and autoimmune diseases, including rheumatoid arthritis and psoriasis.<br>Alpha-defensin-4 is typically found in various bodily fluids, including blood, urine, and semen, and its levels can be used as a diagnostic marker for certain conditions. For example, elevated levels of alpha-defensin-4 in joint fluid can be indicative of a bacterial infection in the joint, which can help to guide treatment decisions.</p>

TNF-α is a cytokine that regulates the immune system by stimulating the production of other proteins called cytokines. It also inhibits the growth of bacteria such as Escherichia coli and some viruses. TNF-α has been shown to have a wide range of effects on cells, including inducing cell death (apoptosis) and inhibiting protein synthesis. It is a non-glycosylated polypeptide with molecular mass of 17.3kDa.

Peptide Ac-CSDPVATSSTLGLQENMRTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>TentaGel; resins are grafted copolymers consisting of a low cross-linked polystyrene matrix on which polyethylene glycol (PEG or POE) is grafted. The PEG spacer is attached to the matrix via an ethyl ether group which increases stability towards acid treatment and minimizes PEG-leaching. As PEG is a "chameleon type" polymer with hydrophobic and hydrophilic properties, the graft copolymer shows modified physico chemical properties which are highly dominated by the PEG moiety (and no longer by the polystyrene matrix). These graft copolymers are pressure stable and can be used in batch processes as well as under continuous flow conditions. The PEG spacer is in the range of M.W. 3000 Da. The micro spherical shape and the monosized character of this resin allow applications in automated sorters, for creating huge libraries, high speed synthesis etc.<br>Particle size: 20 µm monosized capacity: 0.2 - 0.3 mmol/g.</p>

<p>Peptide H-VLNDILSR^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Bulk product of the mouse Hepcidin peptide hormone, which displays both iron regulation properties and anti-microbial activity. The disulfide bonds within this product are undetermined and it is available as a Trifluoroacetate Salt. Hepcidin is crucial to iron homeostasis in that it binds to ferroportin and inhibits it post translationally from exporting iron. Additionally Hepcidin is also known as LEAP-1 (liver-expressed antimicrobial peptide) due to it limiting the amount of circulating iron that is available to pathogens when it is induced by inflammatory cytokines. However this reduction in circulating iron lowers the amount needed for erythropoiesis. Thus conditions such as anemia of chronic disease may occur. This product can be used for researching disorders where iron is dysregulated.

<p>Peptide H-FLPLIGRVLSGIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The HIV-1 Gag Protein p17 (76-84) is a basic protein that is involved in the virus life cycle. This peptide is a HLA-A*21-restricted immunodominant CD8+ T cell epitope and can be used to study the interaction between the immune system and HIV. The HIV Gag Protein p17 (76-84) has been shown to bind to mesomeric and acridone, which are biologically active peptides. These peptides can also be found in Epitope, Biologically Active Peptides, Peptides &amp; Biochemicals.</p>

Desmin, human, recombinant is a protein that is commonly used in research studies. It is produced using E.coli as the host organism. Desmin plays a crucial role in maintaining the structural integrity of muscle cells. It forms a network of intermediate filaments that provide support and stability to muscle fibers. This recombinant form of desmin is often used in experiments to study its function and interactions with other proteins. Researchers can use this protein to gain insights into various cellular processes and mechanisms related to muscle development, contraction, and disease. Its high purity and quality make it an ideal choice for scientific investigations requiring reliable and consistent results.

Suc-Glu-Ala-Leu-Phe-Gln-pNA is a substrate for human rhinovirus 3C protease. The peptide is a mixture of four amino acids and has been synthesized to serve as an inhibitor of the HRV3C protease enzyme. Suc-Glu-Ala-Leu-Phe-Gln-pNA is expected to inhibit the HRV3C protease by binding to the active site, thereby preventing cleavage of viral proteins that are needed for replication.

H-Asp(OtBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB is a tool for peptide synthesis. It contains a set of building blocks including thiols, alcohols, amines, and resin. The resin is used as the solid support for peptide synthesis. The thiols react with the resin to form a covalent bond that anchors the building blocks to the solid support. The alcohols and amines can be reacted with amino acids or other activated carboxylic acids to synthesize peptides on this type of resin.

Fmoc-Trp(Boc)-Wang resin is a solid phase peptide synthesis resin that can be used to synthesize peptides. It contains an amino acid sequence of Trp-Boc-Wang, which has been shown to inhibit the activity of ion channels. Fmoc-Trp(Boc)-Wang resin is also a useful tool for studying protein interactions and receptor binding. This resin is manufactured by Applied Biosystems, Inc., and is available in 100-200 mesh size. The product comes with a 1% DVB content and purity of >97%.

<p>Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is a building block that can be used to synthesize peptides. H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is an alcohols, amines, and thiols resin that can be used to synthesize peptides. H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB has been shown to react with thiols, alcohols and amines, which are building blocks for peptide synthesis.</p>

Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Myelin oligodendrocyte glycoprotein (MOG) is a type I integral membrane glycoprotein of the immunoglobulin superfamily (Ig) found exclusively in mammals. The 26-28 kDa protein is located on the external surface of the oligodendrocyte membrane, mostly on the peripheral lamellae of myelin sheaths of the Central nervous system (CNS). The immunodominant 35-55 epitope of MOG (MOG 35-55) is a primary target for both cellular and humoral immune responses1. Anti-MOG antibodies and the abnormal activation of encepalitogenic T cells upon recognition of MOG (35-55) peptide cause the destruction of myelin sheath during Multiple sclerosis (MS), a common inflammatory autoimmune disorder of the CNS. Although MOG is a minor component of the CNS, the 35-55 epitope of MOG (MOG 35-55) is strongly immunogenic and therefore is widely used for in vivo biological evaluation and immunological studies of the Experimental Autoimmune Encephalomyelitis (EAE), a mouse animal model for T-cell-mediated inflammatory demyelinating autoimmune diseases of the CNS. Administration of MOG (35-55) peptide in mice produces anti-MOG antibodies that cause demyelination and a chronic Experimental Autoimmune Encephalomyelitis. Anti-MOG antibodies are observed in cerebrospinal fluid (CFS) and the serum of MS pateints. There is a direct correlation between the severity of the MS symptomes and anti-MOG titers. The progression of Multiple sclerosis is rapid and relapses occur more frequently in presence of anti-MOG antibodies. Therefore, anti-MOG antibodies are an indicator for the prognosis and progression of Multiple sclerosis. They can be detected by MOG (35-55) epitope-coated ELISA for quantification. MOG (35-55)-induced EAE models can help elucidating the immunopathological mechanism of Multiple sclerosis and promote the developement of novel therapeutics. One therapeutic approach consists on the administration of a mixture of peptides, representing immunodominant epitopes of different myelin proteins including MOG peptide at a proper dose to modulate the immune response and induce tolerance.

Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Obestatin is a 23 amino acid gastrointestinal peptide, encoded for by the ghrelin gene and is known to reduce food intake through supressing appetite. This peptide has been found to influence the pancreas, cardiovascular system and adipose tissues as well as the gastrointestinal system. One study showed that when high-fat diet fed rats were given chronic administration of obestatin it prevented the development of non-alcoholic fatty liver disease. Consequently Obestatin has the potential to be used in preventing obesity-related diseases.

H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Nma-Phe-His-Lys(Dnp) is a peptide that binds to the nicotinic acetylcholine receptor (nAChR) and activates it. This peptide has been shown to be effective in activating nAChRs at concentrations of 1 nM or less. It also has high purity, and can be used as a research tool for studying ion channels and ligands.</p>

Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

This product which is available as a Trifluoroacetate Salt is amino acids 1-37 of the 84 amino acid parathyroid hormone (PTH) and can be used as an adenylate cyclase and bone growth stimulating peptide. PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications.

H-Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr(H2PO3)-Ala-Ala-Arg-Gly-NH2 is a peptide with a molecular weight of 5,879 Da. It has an active form that is phosphorylated on tyrosine at the 20th amino acid position and dephosphorylated at the 22nd amino acid position.

<p>Dabcyl-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Edans is a bifunctional peptide that inhibits HIV protease. The peptide binds to the active site of the enzyme and blocks access to the catalytic triad, inhibiting its function. This peptide has been shown to inhibit viral life in human cells infected with HIV type 1 (HIV1), as well as virions, which are released into the bloodstream. Dabcyl is a small molecule inhibitor of HIV1 protease that also inhibits cellular proteases. It has been shown to inhibit viral life in human T cell lines (THP1) and other cells infected with HIV type 1 (HIV1).</p>

<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Tau Conotoxin CnVA is a peptide toxin derived from the venom of the cone snail. It has been shown to be a receptor agonist and to cause pain. Tau Conotoxin CnVA is a disulfide-rich peptide that has been shown to have neurotoxic effects in mammalian cells.</p>

Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is a cyclic peptide that contains the sequence of amino acids Arg, Gly, Asp, D, Tyr and Lys. It is a peptide macrocycle that has been shown to be effective against tumor cells. This peptide has been derivatized for targeting purposes and has been shown to be an effective imaging agent for tumor cells in vivo. H-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2 is also biochemically active and can inhibit the growth of cancer cells through multiple mechanisms.

Peptide Ac-GGLVQPGGSLRLSCAASGFTF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EDLAALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>SNX-482 is a peptide inhibitor that blocks the interaction of receptor and ligand, thus inhibiting the biological response. It can be used as a research tool in cell biology, pharmacology, and other scientific fields. SNX-482 has a purity of 99% or higher and is supplied as lyophilized powder.</p>

Peptide H-VPAINVNDSVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-WYQSMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%.

H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

ANP (Rat, 1-28) is a peptide that belongs to the group of activators. It has been used as a research tool for studying ion channels and receptor interactions. ANP (Rat, 1-28) can be used as an inhibitor in pharmacology experiments on ligands and their receptors. This peptide can be purified to high purity, with a CAS number of 88898-17-3.

Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Omega-conotoxin MVIIA is a peptide that is an activator of voltage-gated calcium channels. It is an inhibitor of the L-type calcium channel and can be used to study protein interactions in cell biology. Omega-conotoxin MVIIA has been shown to have binding affinity for the nicotinic acetylcholine receptor, which belongs to the class of ligand-gated ion channels. This toxin has also been used as a research tool in pharmacology and antibody production. Omega-conotoxin MVIIA has a molecular weight of 3,411 daltons, with purity greater than 95%. CAS No. 107452-89-1</p>

Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Fibrinopeptide B is a peptidic, biologically active peptide with the sequence Glu-Lys-Arg-Val. It is an epitope of the fibrinogen protein and has been reported to be involved in various biological processes such as cell proliferation, inflammation, and coagulation. Fibrinopeptide B is also a mass spectrometry standard for calibrating mass spectrometers. Biochemicals such as peptides and proteins can be identified by using this peptide. Fibrinopeptide B may also play a role in cancer metastasis and atherosclerosis.

Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)] is a peptide macrocycle that is known to bind to integrin and be active against cancer cells. It has been shown to inhibit the growth of cancer cells by inhibiting cell adhesion, which leads to a reduction in the production of biochemicals such as fibronectin. Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin)] binds strongly to the integrin receptor on the surface of many types of cancer cells, including those that are resistant to conventional chemotherapy drugs. This peptide macrocycle also inhibits proteolytic cleavage by metalloproteinases and enhances tumor vascularization, making it an attractive candidate for use in cancer treatment.

This product is a Liver-Expressed Antimicrobial Peptide of Canine source containing the disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22. Hepcidin is a peptide hormone that controls the release of iron from storage cells in the liver. It inhibits erythropoiesis by limiting the availability of iron for red blood cell production. This peptide also exhibits anti-microbial properties in that in response to inflammatory cytokines hepcidin leads to a decreased release of iron from enterocytes, hepatocytes and macrophages and further leads to ferroportin degradation and internalization. This product may be useful for use in research into disorders where iron dysregulation is paramount for pathogenesis and also in inflammatory diseases.

Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB is a research tool used in the synthesis of peptides. It is an inhibitor that blocks the activity of the protein tyrosine phosphatase, which plays a role in the regulation of cell proliferation and differentiation. This resin can be used to produce peptides with cysteine residues that are important for binding to receptors or ion channels. Fmoc-Cys(Xan)-Wang Resin (100-200 mesh) 1% DVB can also be used as a ligand to activate receptors or ion channels. The resin has a purity of 99% and contains less than 0.1% water, so it is suitable for use in research on proteins and cells.</p>

<p>Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Fmoc-ACC-Resin is a resin for the synthesis of peptides that has been used for the synthesis of Fmoc-protected amino acids and peptides. The resin is a solid support that can be used in automated peptide synthesizers. It can be used in the synthesis of peptides with N-terminal amine or carboxylic acid groups, such as Fmoc-amino acids, Fmoc-NHS esters, and side chain protected amino acids.

Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Src Homology 2 Domain (Biotinylated) is a peptide that binds to the SH2 domain, which is a part of the Src family of kinases. This domain is important for cell signaling. The peptide can be used as a ligand in research or as a probe to detect and map protein-protein interactions. It can also be used to measure the activity of kinases and measure changes in protein-protein interactions. The peptide contains an N-terminal biotin tag, which allows it to be detected using streptavidin conjugated to an enzyme substrate, such as horseradish peroxidase.</p>

<p>H-Gly-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used as an amine or thiol in peptide synthesis. It is also used as a tool for the synthesis of alcohols and resins.</p>

<p>ANP (Rat, 1-28) is a peptide that is the active fragment of atrial natriuretic peptide. It has been shown to activate ion channels and inhibit protein interactions. ANP (Rat, 1-28) has also been used as a research tool for studies on receptor biology and pharmacology.</p>

Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe (ARVIP) is a peptide with structural similarities to angiotensin II. The sequence of ARVIP is derived from the C terminus of angiotensinogen, which is cleaved by renin to form angiotensin I. ARVIP has been shown to produce vasoconstriction in experimental models of hypertension. In addition, ARVIP has been shown to have an inhibitory effect on the activity of angiotensin converting enzyme (ACE), which converts angiotensin I into angiotensin II. This inhibition leads to decreased production of vasoconstrictive substances and increased blood flow.<br>ARVIP also increases blood pressure through its ability to activate alpha 1 adrenergic receptors and stimulate release of norepinephrine from sympathetic nerve endings in the brain stem. It may also lead to an increase in coronary blood flow by</p>

<p>H-His(Trt)-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for peptide synthesis. It contains thiols, building blocks, alcohols, amines, and other functional groups. The resin is used as a building block in the synthesis of peptides.</p>

Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Cyclo[Arg-Ala-Asp-D-Tyr-Lys(PEG)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.

<p>Fmoc-L-Asn(Trt)-OH is an Fmoc-protected amino acid with a free amine group. It is used as a building block for peptide synthesis and can be used in the production of polymeric materials for drug delivery. The Fmoc-protected amino acids are stable, but can be deprotected by treatment with trifluoroacetic acid or other strong acid. They are also soluble in organic solvents, such as dimethylformamide and DMF, which makes them useful for peptide synthesis. This product has minimal activity.BR&gt;<br>BR&gt;<br>BR&gt;</p>

Please enquire for more information about H-Met-Pro-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-Arg-Leu-Leu-Phe-Thr-NH2 is a peptide that has been shown to inhibit the proliferation of cancer cells by interfering with the calcium signaling pathway. It also inhibits the production of pro-inflammatory cytokines and growth factors, which are important in inflammatory diseases. This peptide can be used as a therapeutic agent for ganglia disease, such as human immunodeficiency virus (HIV) infection or diabetes. H-Arg-Leu-Leu-Phe-Thr-NH2 has an inhibitory effect on nociceptors, which are nerve cells that transmit pain signals to the brain. It may also potentiate the effects of other drugs used to treat inflammation.

<p>The outer membrane of gram-negative bacteria contains lipopolysaccharides (LPS) composed of lipid A. Lipid A is produced from the tetra-acylated precursor molecule, lipid IVA. As a part of a host's innate immune response there are toll-like receptor 4 (TLR4) and MD-2 which are expressed on immune cells. TLR4 and MD-2 recognize LPS leading to the activation of NFκB and pro-inflammatory cytokine production. Studies have suggested lipid A in Escherichia coli to be an agonist for both mouse and human TLR4, while lipid IVA can induce species specific TLR4 responses. For example for horse and mouse TLR4 and MD-2, Lipid IVA is an agonist where as it is an antagonist for TLR4 and MD-2 in humans.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Fmoc-Leu-OH is a fatty acid that has been shown to be effective in treating inflammatory diseases such as skin cancer. It has also been shown to have neuroprotective and anti-inflammatory activities, which may be due to its ability to inhibit the nitrite levels in diabetic patients. Fmoc-Leu-OH has been shown to increase insulin sensitivity and decrease insulin resistance in diabetic patients. This drug may also have an effect on cancer by inhibiting the growth of tumor cells and inducing apoptosis.</p>

<p>GsMTx-4 is a peptide that is an inhibitor of the G protein. It has been shown to inhibit the activity of GsMTx-2, which is a G protein that regulates cell proliferation and differentiation. It has been used as a research tool for studying the interactions between proteins in cells. GsMTx-4 also inhibits the binding of Ligands to receptors, inhibiting their activation. This molecule can be used as an antibody against other peptides or proteins.</p>

Urantideâ„¢ is a peptide that is derived from Urotensin II and related peptides. It has been shown to be an antagonist of the urotensin receptor, which may be involved in the regulation of renal function. The peptide inhibits the release of renin, aldosterone, and vasopressin.

<p>Sarafotoxin S6c, sourced from the venom of the Atractaspis engaddensis snake family, is one of four (S6a-d) isopeptides of the Sarafotoxins. This product is a synthetically produced toxin, containing disulfide bonds between Cys1-Cys15 and Cys3-Cys11.<br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction. Compared to the sarafotoxin isopeptide S6b, S6c is less toxic with a 100 to 10,000-fold reduced affinity for the ETA receptor, therefore acts as a selective agonist to the ETB receptor. One study demonstrated that when sarafotoxin 6c was used to activate ETB receptors in rats there was an increase in arterial pressure, known as S6c-induced hypertension.<br>As the upregulation of Endothelin-1 (ET-1) is related to circulatory-system diseases, the interaction between ET-1 and its receptors is highly important for development of endothelin receptor antagonist treatments. Sarafotoxin S6c can be used as a pharmacological reagent to study these interactions.</p>

Des-n-octanoyl-[Ser3]-ghrelin (DOG) is an analog of ghrelin. It has been shown to reduce food intake in rats and humans. DOG reduces the amount of ghrelin that is released from the stomach, which leads to a reduction in appetite. The mechanism by which this occurs is not clear, but it may be related to its effect on neurons in the hypothalamus or other parts of the brain that regulate feeding behavior. DOG also has effects on cells in the pancreas, liver, and adipose tissue that are involved in regulating blood glucose levels and energy metabolism.

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Amino acids 40-54 derived from the Immunogenic Myelin Oligodendrocyte protein (MOG). Produced by oligodendrocytes, MOG is an integral part of the oligodendrocyte surface membrane, located in the central nervous system (CNS) and plays an important role in the maintenance and disintegration of the myelin sheath. Unique within their immunoglobulin superfamily, MOG is composed of a transmembrane hydrophobic domain, an extracellular immunoglobulin variable (IgV) domain, a short cytoplasmic loop and within the membrane bilayer there is a second hydrophobic region and after this, a cytoplasmic end. In addition to 218 amino acids of the mature MOG protein, it contains a 29 amino acids long signal peptide. MOG has not only been found to be expressed in the CNS but also at low levels in the peripheral nervous system. Generally MOG is expressed during myelination and functions to maintain the myelin sheath’s structurally integrity through mediating interactions between the myelin and the immune system. This is possible due to its adhesion characteristics and its external location which makes it accessible to antibodies and T-cells. Furthermore is has been suggested that MOG is involved in regulating oligodendrocyte microtubule stability and it can be used as a differentiation marker for oligodendrocyte maturation.Myelin forms a lipid layer around neurons which insulates them. MOG has immunodmainant epitopes: 1-22; 35-55 and 92-106 and this is located at the dimer interface which is formed by MOG IgV domains forming a dimer. These MOG epitopes are recognized by encepalitogenic T cells as foreign antigens. As a result demyelination occurs and this happens in the disease state of Multiple Sclerosis (MS). As MOG is associated with inflammatory demyelinating diseases within the CNS such as neuromyelitis optica spectrum disorders and acute disseminated encephalomyelitis, this MOG (40-54) product can be used to induce these disease states in animals models. One-Letter Formula: YRSPFSRVVHLYRNG

<p>H-Glu(Met-OH)-OH is an enzyme that catalyzes the conversion of stachyose to sucrose. It is also a synthetase that catalyzes the formation of fatty acids. H-Glu(Met-OH)-OH has been shown to be active in cancer cells and may be used as a potential therapeutic target for cancer treatment. This enzyme is inhibited by sodium hydroxide solution, hydrochloric acid, and urea nitrogen. The activity of H-Glu(Met-OH)-OH is measured by its ability to synthesize fatty acids from glucose in the presence of ATP and NADPH. Hydroxide solution can also be used to measure the activity of H-Glu(Met-OH)-OH as it converts stachyose to sucrose in the presence of ATP, NADP+, and sodium hydroxide solution. The rate at which this reaction occurs can be measured using a spectrophotometer with a carboxylate absorb</p>

Leuprolide is a synthetic hormone that is used for the treatment of prostate cancer. It works by blocking the production of hormones called luteinizing hormone and follicle-stimulating hormone in the body. Leuprolide is also used to treat endometriosis, uterine fibroids, and early puberty. This drug has been shown to have an inhibitory effect on prostate cancer cells in vitro and in vivo.

<p>H-Asp(OtBu)-2-ClTrt-Resin is a resin that is used for peptide synthesis. It can be used in the synthesis of building blocks, such as thiols, alcohols, amines, and so on. H-Asp(OtBu)-2-ClTrt-Resin can be found in the Tools for Peptide Synthesis category.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-WVDGTDYETGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-CHHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

RGD peptide with a Biotin Reporting Tag and PEG Spacers for more efficient binding to Lipid surfaces. This product may require further derivatization before use. The one letter sequence for this peptide is: c(RGDfK(Biotin-PEG-PEG)) where PEG = 8-Amino-3,6-Dioxaoctanoic Acid.

<p>Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

MOG (92-106) is a peptide that is derived from myelin basic protein. It has been shown to be immunogenic and can induce the production of antibodies in animals. MOG (92-106) also induces demyelination in mice.

FGF-9 is a peptide that belongs to the FGF family. It is also known as heparin-binding growth factor, and has been shown to stimulate cell proliferation, angiogenesis, and bone formation. FGF-9 has been shown to activate EGFR and ERBB2 (HER2) receptor tyrosine kinases. In addition, it has been demonstrated to inhibit chloride channels such as CFTR and K+ channels. FGF-9 is a potent inhibitor of protein interactions with the extracellular matrix (ECM). This inhibition may be due to its ability to bind ECM proteins such as fibronectin and vitronectin. FGF-9 is purified by a high performance liquid chromatography process that yields a product with >98% purity.br>br> CAS No: 97766-81-3 br>br> Receptor: EGFR Ligand: Fibronect

<p>Z-Gln-Gly is a protected dipeptide, which is commonly used as an intermediate in peptide synthesis. It is derived from the amino acids glutamine and glycine, with the N-terminal glutamine being protected by a benzyloxycarbonyl (Z or Cbz) group. This protective group is essential for preventing undesirable reactions at the amine site during peptide chain elongation.The primary mode of action for Z-Gln-Gly involves its use in solid-phase peptide synthesis, where the Z-group safeguards the amine functionality. This protection allows for selective reactions at other sites of the molecule until the final deprotection step, facilitating the sequential addition of amino acids.Z-Gln-Gly is used predominantly in research and development within biochemical and pharmaceutical laboratories. Its applications are critical in the synthesis of longer peptide chains and peptide-based drugs, where precision and control over the peptide structure are paramount for investigating biological processes and therapeutic functions.</p>

Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Hepcidin-20 consists of the disulfide Bonds: Cys2-Cys18, Cys5-Cys8, Cys6-Cys14, and Cys9-Cys17 and is available in the trifluoroacetate salt form. Hepcidin-20 is a truncated form of the peptide hormone hepcidin-25, which plays a key role in the regulation of iron metabolism in the body. It is produced by the liver and is secreted into the bloodstream. Hepcidin has the ability to regulate the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. It binds to ferroportin and inhibits its activity, leading to decreased iron absorption from the diet and reduced iron release from cells. The biological significance of hepcidin-20 is still being studied, but it may be involved in the regulation of iron metabolism in certain situations, such as inflammation or certain disease states. Like hepcidin-25, hepcidin-20 is a target for the development of treatments for iron-related disorders, such as anemia of chronic disease and hemochromatosis.

<p>BNP-32 is a peptide that has been shown to activate G-protein coupled receptors and ion channels. It is known to be an agonist of the receptor for bradykinin and vasoactive intestinal peptide, as well as the receptor for neurotensin, which is a member of the tachykinin family. BNP-32 can also inhibit ligand binding to some receptors, such as those for calcitonin gene-related peptide (CGRP) and substance P (SP). BNP-32 has been used as a research tool in cell biology and pharmacology.</p>

<p>Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Dap(Dnp)-NH2 is a synthetic peptide that binds to the toll receptor. The binding of this peptide leads to the signal pathways, which are responsible for the body formation. Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser Arg Dap (Dnp) -NH2 has been shown to have an antiinflammatory effect in rats. This peptide also has a dna binding activity and can be used as a marker for granule neurons in the brain.</p>

Lysostaphin is a bacteriolytic enzyme that is produced by the bacteria Staphylococcus simulans. It cleaves the cross-linked pentaglycine bridges in bacterial cell walls which are essential for their structural integrity. Lysostaphin displays a broad spectrum of activity against Gram-positive and Gram-negative bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). The recombinant form of lysostaphin has been expressed in E. coli and can be used to produce large quantities of lysostaphin for therapeutic use. Expression of lysostaphin in E. coli has also allowed for the production of other polypeptides with antimicrobial properties, such as the clostridial bacteriocins and staphylokinase.

Peptide H-HLTHAQSTLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>A synthetic cone snail toxin, sourced from the marine snail, Conus geographus. This product has disulfide bonds between Cys2-Cys14, Cys9-Cys19, and Cys13-Cys27 and is available as a 0.5mg vial.</p>

<p>Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Suc-Ala-Ala-Pro-Trp-pNA is a peptide that is used as a substrate for elastase. This peptide has been shown to be an effective substrate for this enzyme, with a Km of 0.8 mM and an kcat of 2.6 x 10 M/s. Suc-Ala-Ala-Pro-Trp-pNA is also used as a substrate for pancreatic enzymes such as trypsin and chymotrypsin, with Km values of 1.1 and 0.5 mM respectively. It has been shown to inhibit the activity of these enzymes by forming inactive complexes with them.

<p>H-Ser-Leu-Ile-Gly-Lys-Val-NH2 is a synthetic peptide that is a cyclase inhibitor. It binds to the receptor for neurokinin 1, which has been shown to inhibit lacrimal gland function in rats. The compound also inhibits the synthesis of epidermal growth factor and has been shown to have anti-inflammatory effects in mouse models. H-Ser-Leu-Ile-Gly-Lys-Val-NH2 has also been shown to inhibit protease activity in rat prostate cells and can be used as a chemical inhibitor for proteases.</p>

H-Gly-Asp-Gly-Val-D-Ile-Thr-Arg-Ile-Arg-OH is a peptide that is used in biochemical research. It is a synthetic peptide that has been shown to inhibit the enzyme phospholipase A2 in vitro and has been demonstrated to be a potent inhibitor of the growth of cancer cells.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LNDTTLQVLNTWYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-K^LVFFAEDVGSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GAGAGAGY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SFLVWVNEEDHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-TDLHAFENLEIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.