Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29608 productos de "Péptidos"
H-LNIPTDVLK^-OH
Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ghrelin (Human, Rat, 1-5)
Amino acids 1-5 of the peptide hormone Ghrelin which exerts its various effects through associating with the growth hormone secretagogue receptor (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. Ghrelin is found in the stomach, brain and other tissues and is involved in stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and its key role in glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Fórmula:C31H51N6O8Pureza:Min. 95%Peso molecular:634.78 g/molH-ARTKQTARKSTGGKA-NH2
Peptide H-ARTKQTARKSTGGKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Abz-Gly-Phe-Ser-Pro-Tyr(NO2)-OH
Abz-Gly-Phe-Ser-Pro-Tyr(NO2)-OH is a peptide that can be used as an angiotensin I converting enzyme II substrate. It is a synthetic, non-peptide molecule that has been shown to inhibit the activity of the angiotensin I converting enzyme (ACE). This inhibition prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilation and decreased blood pressure.Fórmula:C35H39N7O11Pureza:Min. 95%Peso molecular:733.74 g/molMet-MCA
CAS:Met-MCA is a peptide that can be used as an activator, antibody, or receptor. CAS No. 94367-34-7. It is a high purity product with high quality and good stability in salt solution or in PBS (PH 7.4). It inhibits ion channels and has been shown to inhibit the interactions of proteins. Met-MCA can be used as a pharmacological tool for research on protein interactions and ligand/receptor binding.Fórmula:C15H18N2O3SPureza:Min. 95%Peso molecular:306.38 g/molH-Ser-Leu-Ile-Gly-Arg-Leu-OH
CAS:H-Ser-Leu-Ile-Gly-Arg-Leu-OH is a peptide that is derived from the amino acid sequence of the Protease Activated Receptor (PAR) and has been shown to be an inhibitor of PAR4. It has been shown to inhibit coagulation, myocardial infarct, cytosolic Ca2+, and receptor activity in vitro. H-Ser-Leu-Ile-Gly-Arg-Leu-OH has also been shown to decrease blood pressure in mice by inhibiting cyclase activity and reducing vascular reactivity.Fórmula:C29H55N9O8Pureza:Min. 95%Peso molecular:657.82 g/molH-Ser-Phe-Leu-Leu-Arg-Asn-NH2
CAS:This is a monoclonal antibody that binds to the alpha-integrin receptor. The alpha-integrin receptor is an integrin that is involved in cell adhesion and migration, as well as the activation of several signaling pathways. This antibody has been shown to inhibit the binding of alpha-integrins to phospholipid membranes, which may be due to inhibition of protein kinase C (PKC). This antibody also inhibits thrombin receptor activation and dextran sulfate-induced cytosolic calcium mobilization.
Fórmula:C34H57N11O8Pureza:Min. 95%Peso molecular:747.9 g/molH-GLQTSQDAR^-OH
Peptide H-GLQTSQDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIAALLSPYSYSTTAVVTNPK^E-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITIRPR^-OH
Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 53 (ENTRATKMQVIGDQY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,754 g/molLCBiot-YAPP-OH
Peptide LCBiot-YAPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Ser(tBu)-Rink-Amide MBHA Resin
The resin is used for the synthesis of peptides and other small molecules. The resin is a polystyrene-divinylbenzene copolymer that is functionalized with an amino acid sequence. It can be used in automated peptide synthesizers to perform solid phase peptide synthesis.
Pureza:Min. 95%Neuromedin U8 (Porcine)
CAS:Neuromedin U8 (Porcine) is a peptide that binds to the receptor for Neuromedins. It has been shown to inhibit cell proliferation and induce apoptosis in some cancer cells. Neuromedin U8 has also been shown to have a protective effect on the bowel by inhibiting inflammatory bowel disease. The peptide is also known to be active on other physiological functions and metabolic disorders, such as amide metabolism and hypertrophy, which are due to its conformational properties.
Fórmula:C54H78N16O10Pureza:Min. 95%Peso molecular:1,111.32 g/molAla-Asp-Ser-Asp-Pro-Arg
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C25H41N9O12Peso molecular:659.65 g/molOxyntomodulin, Glucagon-37 (Porcine)
CAS:Oxyntomodulin, a peptide hormone made up of 37 amino acids, is produced and released from gut endocrine L-cells. It has the ability to regulate gastric acids secretion in the gastric oxyntic glands. Oxyntomodulin, Glucagon-37 (Porcine) product is avaiable in the Trifluoroacetate salt form and can be used as an inhibitor of gastric acid secretion and pancreatic enzyme secretion. It has also been shown to reduce food intake and increase energy expenditure in humans. Central injection of oxyntomodulin reduces food intake and weight gain in rodents, suggesting that oxyntomodulin signals food ingestion to hypothalamic appetite-regulating circuits.Fórmula:C192H295N59O60SPureza:Min. 95%Peso molecular:4,421.92 g/molH-IQPTTPSEPTAIK^-OH
Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(Arg-Gly-Glu-D-Phe-Lys)
Cyclo(Arg-Gly-Glu-D-Phe-Lys) is a cyclic peptide that has been used as an inhibitor of the signaling pathway in cells. Cyclo(Arg-Gly-Glu-D-Phe-Lys) binds to the receptor, which may be associated with an ion channel and the activation of a G protein. This peptide can act as a competitive inhibitor of other ligands for this receptor. Cyclo(Arg-Gly-Glu-D-Phe-Lys) is also known to be an activator for some receptors, including the angiotensin II type 1 receptor (AT1). This peptide has been used as a research tool to study receptor function and cellular signaling pathways. It is also being investigated for use in antibody production.Fórmula:C28H43N9O7Pureza:Min. 95%Peso molecular:617.71 g/molFmoc-FAVP
Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSIR^-OH
Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Doxorubicin hydrochloride
CAS:Doxorubicin is a cytotoxic drug that belongs to the class of anthracyclines. It is used as an anticancer agent and in the treatment of various types of cancer. Doxorubicin has been shown to inhibit glucose uptake by cells, which may be due to its ability to form disulfide bonds with proteins. Doxorubicin also binds to iron-sulfur clusters, causing cell lysis, which may lead to tumor necrosis. In vitro assays have shown that doxorubicin inhibits drug transporter function, leading to reduced cellular uptake of drugs.Fórmula:C27H29NO11•HClPureza:Min. 95%Peso molecular:579.98 g/molBoc-D-Trp(CHO)-OH
CAS:Boc-D-Trp(CHO)-OH is a synthetic peptide. It is an activator of ion channels and has been used to study the interactions between ligands and receptors. This product is suitable for life science, cell biology, pharmacology, and other research applications. Boc-D-Trp(CHO)-OH can be used as a research tool in studying protein interactions and receptor functions.Fórmula:C17H20N2O5Pureza:Min. 95%Peso molecular:332.35 g/molCpp-AAF-pAb
CAS:Cpp-AAF-pAb is a synthetic peptide that corresponds to the amino acid sequence of the C terminus of human basic fibroblast growth factor (bFGF) and has been shown to have a variety of effects on cells. It has been used in cell culture studies to measure the effect of bFGF on renal blood flow, which is an important marker for kidney disease. In addition, this peptide inhibits tumor cell growth and has antinociceptive properties in rats. The inhibition of tumor cell growth may be due to its ability to inhibit metalloendopeptidases and polyclonal antibodies.Fórmula:C32H36N4O7Pureza:Min. 95%Peso molecular:588.67 g/molMartentoxin I
A synthetic scorpion toxin, sourced from the Scorpion, Buthus martensi which has the following disulfide bonds: Cys8-Cys29, Cys14-Cys34, and Cys18-Cys36. This product is available in the trifluoroacetate salt form. One-Letter-Code: FGLIDVKCFA SSECWTACKK VTGSGQGKCQ NNQCRCYFórmula:C162H253N49O52S6Pureza:Min. 95%Peso molecular:3,911.5 g/molCys-TAT (49-57)
Cys- Modified HIV TAT Sequence 49-57, a derivatizable cell-penetrating peptide (CPP) for click chemistry. Product available as a Trifluoroacetate SaltFórmula:C56H112N32O11SPureza:Min. 95%Peso molecular:1,441.79 g/molH-DMQLGR^-OH
Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotinylated TAT (47-57)
Biotinylated Tat Peptide available in the trifluroacetate salt form. TAT(Transactivated-transcripiton) Peptide Derived from the HIV TAT Protein, is a Cell-Penetrating Peptide which has the ability to transport itself across cell membranes independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics.Fórmula:C74H132N34O16SPureza:Min. 95%Peso molecular:1,786.16 g/molH-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH
H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C275H477N125O51Peso molecular:6,350.54 g/molSLC38A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A1 antibody, catalog no. 70R-1754Pureza:Min. 95%PGP 9.5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PGP 9.5 antibody, catalog no. 20R-PG011Pureza:Min. 95%H-LDSIICVK^-OH
Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gad1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Gad1 antibody, catalog no. 70R-9261Pureza:Min. 95%H-Met-Pro-OH·HCl
CAS:Please enquire for more information about H-Met-Pro-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C10H18N2O3S•HClPureza:Min. 95%Forma y color:PowderPeso molecular:282.79 g/molHepcidin (Rat) (Bulk)
Consisting of the following disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, Cys14-Cys22, this product is a rat Hepcidin peptide hormone available as a Trifluoroacetate Salt. Hepcidin is a hormone that regulates iron homeostasis in mammals. It is synthesized by hepatocytes and released into the blood, where it binds to ferroportin, expressed on the surface of cells lining the small intestine. Through binding to ferroportin, Hepcidin inhibits ferroportin's function and prevents iron from being absorbed from the gut.Fórmula:C111H169N31O35S8Pureza:Min. 95%Peso molecular:2,712.2 g/molAc-GEGQQHHLGGAKQAGDV-OH
Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HRKy peptide
HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.Alpha-Conotoxin ImI
CAS:Alpha-conotoxin ImI is a peptide that belongs to the class of alpha-conotoxins. It is an activator of nicotinic acetylcholine receptors, which inhibit voltage-gated calcium channels. The high purity of this product allows for its use in research and development. Alpha-conotoxin ImI has been used to study protein interactions and receptor pharmacology.Fórmula:C52H78N20O15S4Pureza:Min. 95%Peso molecular:1,351.6 g/molH-Phe-Leu-Leu-Arg-Asn-OH
CAS:H-Phe-Leu-Leu-Arg-Asn-OH is a β-amino acid that has been shown to have antioxidant properties. It acts as a competitive inhibitor of the enzyme collagenase and has been shown to inhibit the development of atherosclerotic lesions in mice. The amide form of H-Phe-Leu-Leu-Arg-Asn has also been shown to have site specific activity on ventricular myocardium cells, which may be related to its ability to induce cytosolic calcium release. HPLR also has protease activity that can be inhibited by urea nitrogen and β amino acid. Basophilic leukemia cells produce HPLR at high levels and it is thought that this is due to an increased requirement for the production of collagen in these cells. HPLR has been shown to activate thrombin receptors, which are found on the surface of platelets and endothelial cells. Activated thrombinFórmula:C31H51N9O7Pureza:Min. 95%Peso molecular:661.81 g/molH-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It is a thiol-reactive resin with a pendant amine group. H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in common organic solvents and can be used for the synthesis of peptides with amino acids containing aromatic rings.Pureza:Min. 95%TentaGel® HL-NH2 Resin
TentaGel resin; constructed with a backbone of low cross-linked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. TentaGel; HL (High Load) (mean particle size 110 µm: capacity 04-06 meq/g)Pureza:Min. 95%H-YTDV^SNMSHLA-OH
Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FK18
FK18 is a basic fibroblastic growth factor that has been shown to promote neuronal survival and is neuroprotective. It also can prevent glutamate-induced neurotoxicity in the central nervous system (CNS) by inhibiting glutamate release from the synaptic cleft, which leads to neuronal death. FK18 has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins and other inflammatory mediators. FK18 has also been shown to reduce necrotic cell death by decreasing mitochondrial membrane potential.Fórmula:C107H155N31O31Pureza:Min. 95%Peso molecular:2,371.62 g/molTirzepatide
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Fórmula:C225H348N48O68Pureza:Min. 95%Forma y color:PowderPeso molecular:4,813 g/molPhosphoramidon
CAS:Phosphoramidon is a phosphonate compound that inhibits the binding of two enzymes, cholinesterase and butyrylcholinesterase. It has been shown to cause a bronchoconstrictor response in mice, inhibit mesenteric enzyme activities, and inhibit cardiac enzyme activity in rats. Phosphoramidon is used as an experimental drug for treatment of myocardial infarcts. It also has an effect on the central nervous system by acting on neurokinin-1 receptors and kappa-opioid receptors.
Phosphoramidon is a monosodium salt with biochemical properties similar to those of other members of this class of drugs.Fórmula:C23H32N3O10P•2Na•2H20Pureza:Min. 95%Peso molecular:623.5 g/molH-GELNEHLGLLGPYIR^-OH
Peptide H-GELNEHLGLLGPYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITLYLK^-OH
Peptide H-ITLYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotinyl-Gly-Gly-OH
CAS:Please enquire for more information about Biotinyl-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C14H22N4O5SPureza:Min. 95%Peso molecular:358.41 g/molH-GDLGIEIPAEK^-OH
Peptide H-GDLGIEIPAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
