Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 29639 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
LCBiot-KKRYDREFLLGF-OH
Peptide LCBiot-KKRYDREFLLGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Ala1)-PAR-4 (1-6) amide (mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C34H48N8O7Peso molecular:680.8 g/molMelanocyte Protein PMEL 17 (44-59) (human, bovine, mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C95H137N27O28Peso molecular:2,105.3 g/molChloromethylated Polystyrene Resin (200-400 mesh) 1% DVB
CAS:Chloromethylated Polystyrene Resin (200-400 mesh) 1% DVB is a reaction solution that is used in biological studies. It reacts with human serum to form a bicyclic heterocycle. The hydrogen fluoride in the reaction solution reacts with the trifluoroacetic acid to form an intermediate, which then reacts with the chloromethylated polystyrene resin to form the bicyclic heterocycle. The redox potentials of this reaction are measured and can be used as a probe for determining the chemical stability of this product. This product has been shown to have fluorescence properties and can be used as a probe for detecting DNA and RNA samples in vitro.Pureza:Min. 95%Urotensin II (Human) Antiserum
Urotensin II (Human) Antiserum is a research tool for the study of ion channels and receptors. Urotensin II is a peptide that interacts with the G-protein coupled receptor, UTA1. The purified antibody can be used to detect the presence of this peptide in a sample by Western blotting or ELISA. This product is supplied in high purity and has not been shown to react with any other protein.
Pureza:Min. 95%H-LGYPITDDLDIYTR^-OH
Peptide H-LGYPITDDLDIYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEETVQAK^-OH
Peptide H-LEETVQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], Acetylated, Amide, Phosphorylated
Catalogue peptide; min. 95% purityFórmula:C66H110N23O24PPeso molecular:1,640.75 g/molNeuromedin U-23 (rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C124H180N34O31Peso molecular:2,643 g/molH-Asp(OtBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Asp(OtBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB is a tool for peptide synthesis. It contains a set of building blocks including thiols, alcohols, amines, and resin. The resin is used as the solid support for peptide synthesis. The thiols react with the resin to form a covalent bond that anchors the building blocks to the solid support. The alcohols and amines can be reacted with amino acids or other activated carboxylic acids to synthesize peptides on this type of resin.Pureza:Min. 95%H-LSEPAELTDAVK^-OH
Peptide H-LSEPAELTDAVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Ala-Ala-Arg-Gly-NH2
CAS:This peptide hormone is a member of the lipid-binding proteins. It is a basic protein that has been found to be expressed in human leukemia cells and may have an important function in cellular transformation. The hl-60 cells, treated with this agent, show changes in cell shape and motility. Epidermal growth factor (EGF) receptors are activated by this fatty acid, which leads to an increase in the production of EGF by the cells. This peptide hormone has been shown to bind to the epidermal growth factor receptor and stimulate the production of EGF. Monoclonal antibodies can be used to identify this peptide hormone. The binding sites for this peptide hormone are dinucleotide phosphate or cytosolic proteins. This peptide hormone has been associated with autoimmune diseases such as rheumatoid arthritis and psoriatic arthritis.Fórmula:C64H106N22O21Pureza:Min. 95%Peso molecular:1,519.69 g/mol2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C80H138N26O24S2Peso molecular:1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 124
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,714.9 g/molN-(4-Biphenylacetyl)-Cys(Me)-D-Arg-Phe-N-Phenylethylamide
CAS:N-(4-Biphenylacetyl)-Cys(Me)-D-Arg-Phe-N-Phenylethylamide is an inhibitor of serine proteases. It prevents the breakdown of proteins, which may result in a number of pathologies. N-(4-Biphenylacetyl)-Cys(Me)-D-Arg-Phe-N-Phenylethylamide has been shown to prevent reperfusion injury and proteinuria in mice by inhibiting renal inflammation and oxidative stress. This compound has also been shown to be effective in preventing the development of cancer, for example prostate cancer, by inhibiting angiogenesis, leading to reduced vascularization.Fórmula:C41H49N7O4SPureza:Min. 95%Peso molecular:735.96 g/molHXB2 gag NO-103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,776.1 g/molH-QIVQNLR^-OH
Peptide H-QIVQNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVEIGSFLLGR^-OH
Peptide H-AVEIGSFLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQYNSTYR^-OH
Peptide H-EEQYNSTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Met-MCA
CAS:Met-MCA is a peptide that can be used as an activator, antibody, or receptor. CAS No. 94367-34-7. It is a high purity product with high quality and good stability in salt solution or in PBS (PH 7.4). It inhibits ion channels and has been shown to inhibit the interactions of proteins. Met-MCA can be used as a pharmacological tool for research on protein interactions and ligand/receptor binding.Fórmula:C15H18N2O3SPureza:Min. 95%Peso molecular:306.38 g/molH-TTPPVLDSDGSFFLYSK-OH
Peptide H-TTPPVLDSDGSFFLYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C196H299N53O55SPureza:Min. 95%Forma y color:PowderPeso molecular:4,309.86 g/molH-Ser-Leu-Ile-Gly-Arg-Leu-OH
CAS:H-Ser-Leu-Ile-Gly-Arg-Leu-OH is a peptide that is derived from the amino acid sequence of the Protease Activated Receptor (PAR) and has been shown to be an inhibitor of PAR4. It has been shown to inhibit coagulation, myocardial infarct, cytosolic Ca2+, and receptor activity in vitro. H-Ser-Leu-Ile-Gly-Arg-Leu-OH has also been shown to decrease blood pressure in mice by inhibiting cyclase activity and reducing vascular reactivity.Fórmula:C29H55N9O8Pureza:Min. 95%Peso molecular:657.82 g/molH-YFDSFGDLSSASAIMGNAK^-OH
Peptide H-YFDSFGDLSSASAIMGNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ProTx-II
CAS:ProTx-II is a synthetic peptide that activates the TRPV1 receptor, a member of the capsaicin receptor family. ProTx-II has been shown to inhibit NGF-induced neurite outgrowth, and can be used as a research tool in studying the structure and function of TRPV1 receptors. ProTx-II is also an inhibitor of protein interactions with the TNF receptor, and has been shown to selectively inhibit NFκB activation by inhibiting IKK kinase activity.Fórmula:C168H250N46O41S8Pureza:Min. 95%Peso molecular:3,826.6 g/mol5TAMRA-LKRYKRRL-OH
Peptide 5TAMRA-LKRYKRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-KRMKVAKNAQ-OH
Peptide Myr-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLAVYQAGAR^-OH
Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuromedin U8 (Porcine)
CAS:Neuromedin U8 (Porcine) is a peptide that binds to the receptor for Neuromedins. It has been shown to inhibit cell proliferation and induce apoptosis in some cancer cells. Neuromedin U8 has also been shown to have a protective effect on the bowel by inhibiting inflammatory bowel disease. The peptide is also known to be active on other physiological functions and metabolic disorders, such as amide metabolism and hypertrophy, which are due to its conformational properties.
Fórmula:C54H78N16O10Pureza:Min. 95%Peso molecular:1,111.32 g/molH-QGGFLGLSNIK^-OH
Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Oxyntomodulin, Glucagon-37 (Porcine)
CAS:Oxyntomodulin, a peptide hormone made up of 37 amino acids, is produced and released from gut endocrine L-cells. It has the ability to regulate gastric acids secretion in the gastric oxyntic glands. Oxyntomodulin, Glucagon-37 (Porcine) product is avaiable in the Trifluoroacetate salt form and can be used as an inhibitor of gastric acid secretion and pancreatic enzyme secretion. It has also been shown to reduce food intake and increase energy expenditure in humans. Central injection of oxyntomodulin reduces food intake and weight gain in rodents, suggesting that oxyntomodulin signals food ingestion to hypothalamic appetite-regulating circuits.Fórmula:C192H295N59O60SPureza:Min. 95%Peso molecular:4,421.92 g/molDoxorubicin hydrochloride
CAS:Doxorubicin is a cytotoxic drug that belongs to the class of anthracyclines. It is used as an anticancer agent and in the treatment of various types of cancer. Doxorubicin has been shown to inhibit glucose uptake by cells, which may be due to its ability to form disulfide bonds with proteins. Doxorubicin also binds to iron-sulfur clusters, causing cell lysis, which may lead to tumor necrosis. In vitro assays have shown that doxorubicin inhibits drug transporter function, leading to reduced cellular uptake of drugs.Fórmula:C27H29NO11•HClPureza:Min. 95%Peso molecular:579.98 g/molH-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLKEIFKAGLGSLVKGIAAHVAS-NH2
Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PPAHGVTSAPDTRPA-NH2
Peptide Biot-PPAHGVTSAPDTRPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-D-Trp(CHO)-OH
CAS:Boc-D-Trp(CHO)-OH is a synthetic peptide. It is an activator of ion channels and has been used to study the interactions between ligands and receptors. This product is suitable for life science, cell biology, pharmacology, and other research applications. Boc-D-Trp(CHO)-OH can be used as a research tool in studying protein interactions and receptor functions.Fórmula:C17H20N2O5Pureza:Min. 95%Peso molecular:332.35 g/molAc-RFAAKAA-OH
Peptide Ac-RFAAKAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hepcidin (Rat) (Bulk)
Consisting of the following disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, Cys14-Cys22, this product is a rat Hepcidin peptide hormone available as a Trifluoroacetate Salt. Hepcidin is a hormone that regulates iron homeostasis in mammals. It is synthesized by hepatocytes and released into the blood, where it binds to ferroportin, expressed on the surface of cells lining the small intestine. Through binding to ferroportin, Hepcidin inhibits ferroportin's function and prevents iron from being absorbed from the gut.Fórmula:C111H169N31O35S8Pureza:Min. 95%Peso molecular:2,712.2 g/molSuc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C32H40N6O9Peso molecular:652.7 g/molH2N-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Ty
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C111H156N24O28Peso molecular:2,274.57 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTVAGLAGK^-OH
Peptide H-VTVAGLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Phe-Leu-Leu-Arg-Asn-OH
CAS:H-Phe-Leu-Leu-Arg-Asn-OH is a β-amino acid that has been shown to have antioxidant properties. It acts as a competitive inhibitor of the enzyme collagenase and has been shown to inhibit the development of atherosclerotic lesions in mice. The amide form of H-Phe-Leu-Leu-Arg-Asn has also been shown to have site specific activity on ventricular myocardium cells, which may be related to its ability to induce cytosolic calcium release. HPLR also has protease activity that can be inhibited by urea nitrogen and β amino acid. Basophilic leukemia cells produce HPLR at high levels and it is thought that this is due to an increased requirement for the production of collagen in these cells. HPLR has been shown to activate thrombin receptors, which are found on the surface of platelets and endothelial cells. Activated thrombinFórmula:C31H51N9O7Pureza:Min. 95%Peso molecular:661.81 g/molPhosphoramidon
CAS:Phosphoramidon is a phosphonate compound that inhibits the binding of two enzymes, cholinesterase and butyrylcholinesterase. It has been shown to cause a bronchoconstrictor response in mice, inhibit mesenteric enzyme activities, and inhibit cardiac enzyme activity in rats. Phosphoramidon is used as an experimental drug for treatment of myocardial infarcts. It also has an effect on the central nervous system by acting on neurokinin-1 receptors and kappa-opioid receptors.
Phosphoramidon is a monosodium salt with biochemical properties similar to those of other members of this class of drugs.Fórmula:C23H32N3O10P•2Na•2H20Pureza:Min. 95%Peso molecular:623.5 g/mol5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Ala-Asp-D-Tyr-Lys)
Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is a peptide macrocycle that has been shown to have potent anti-cancer activity. It binds to the receptor for epidermal growth factor (EGF), which is overexpressed in many cancers, and inhibits its function. Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is also able to inhibit the production of nitric oxide by inhibiting the synthesis of arginase. This peptide has also been shown to induce apoptosis in cancer cells by altering the mitochondrial membrane potential and activating caspases 3 and 9.Fórmula:C28H43N9O8Pureza:Min. 95%Peso molecular:633.70 g/molPremelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIDTVLPNK^-OH
Peptide H-EIDTVLPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Tyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], Acetylated, Amide, Phosphorylated](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00046.webp&w=3840&q=75)
