
Halogénures organiques
Dans cette catégorie, vous trouverez des molécules organiques contenant un ou plusieurs atomes d'halogène dans leur structure. Ces halogénures organiques incluent des composés bromés, iodés, chlorés et des halogénures cycliques. Les halogénures organiques sont largement utilisés en synthèse organique, en pharmaceutique, en agrochimie et en science des matériaux en raison de leur réactivité et de leur capacité à subir une variété de transformations chimiques. Chez CymitQuimica, nous offrons une sélection complète d'halogénures organiques de haute qualité pour soutenir vos applications de recherche et industrielles, garantissant une performance fiable et efficace dans vos projets synthétiques et analytiques.
Sous-catégories appartenant à la catégorie "Halogénures organiques"
20437 produits trouvés pour "Halogénures organiques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Dichloroacetyl chloride
CAS :<p>Dichloroacetyl chloride is a reactive chlorine compound that is used in the synthesis of pharmaceuticals, dyes, and pesticides. It reacts with hydrochloric acid to produce hydrochloric acid and dichloroacetic acid. Dichloroacetyl chloride can react with zirconium oxide to produce chlorides and zirconates. This reaction can be conducted at room temperature. The reaction mechanism for this reaction is not well understood; however, it has been shown that the hydroxyl group on the dichloroacetyl chloride molecule plays a significant role in this process. The phase transition temperature of dichloroacetyl chloride is -60°C. This compound has physiological activities such as reducing inflammation and fighting autoimmune diseases.</p>Formule :C2HCl3ODegré de pureté :Min. 95%Masse moléculaire :147.39 g/molMethyl3-iodothiophene-2-carboxylate
CAS :<p>Methyl3-iodothiophene-2-carboxylate is a chemical compound that is involved in the biosynthesis of eicosanoids. It can be synthesized by the cyclization of the corresponding lactam to produce an intermediate, which is then converted to methyl3-iodothiophene-2-carboxylate by hydrolysis or reduction. This compound has been shown to inhibit malaria parasites such as Plasmodium falciparum and Plasmodium vivax. Methyl3-iodothiophene-2-carboxylate also inhibits the growth of bacteria such as Staphylococcus aureus and Bacillus subtilis. The mechanism of action is believed to be due to its ability to inhibit protein synthesis by binding with ribosomes in prokaryotic cells.END></p>Formule :C6H5IO2SDegré de pureté :Min. 95%Masse moléculaire :268.07 g/mol4-Fluorobenzene-1,3-dioyl dichloride
CAS :<p>Please enquire for more information about 4-Fluorobenzene-1,3-dioyl dichloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H3Cl2FO2Degré de pureté :Min. 95%Masse moléculaire :221.01 g/mol1-Acetyl-4-(2,4-difluorobenzyl)piperazine
CAS :Produit contrôlé<p>Please enquire for more information about 1-Acetyl-4-(2,4-difluorobenzyl)piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H16F2N2ODegré de pureté :Min. 95%Masse moléculaire :254.28 g/molBistrifluoromethanesulfonimide
CAS :<p>Bistrifluoromethanesulfonimide is a cationic ionic liquid that has been shown to have a high thermal expansion coefficient. It has been used in the synthesis of copper chloride and as an electrolyte for electrochemical impedance spectroscopy. The solubility of bistrifluoromethanesulfonimide can be increased by adding lithium ions, which results in a higher activation energy for intramolecular hydrogen bonding interactions. Bistrifluoromethanesulfonimide can also be used as a surfactant in the synthesis of ionic liquids through the addition of sodium dodecyl sulfate, which leads to hydrogen bonding interactions with other molecules.</p>Formule :C2HF6NO4S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :281.16 g/mol2-(Bromomethyl)-1-methyl-1H-benzimidazole hydrobromide
CAS :Produit contrôlé<p>Please enquire for more information about 2-(Bromomethyl)-1-methyl-1H-benzimidazole hydrobromide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C9H9BrN2Degré de pureté :Min. 95%Masse moléculaire :225.09 g/mol1-(3,4-Dichlorobenzyl)piperazine
CAS :Produit contrôlé<p>1-(3,4-Dichlorobenzyl)piperazine is an amine that is used as a reagent in organic synthesis. It is a buffered, acidic compound that emits fluorescence under UV light. It has been shown to be an electron donor and electron acceptor. 1-(3,4-Dichlorobenzyl)piperazine reacts with phenylpiperazines in the presence of acid to form a mixture of phenylpiperazines with different aliphatic chains. The reaction is characterized by emission of fluorescence that can be measured using spectroscopy techniques.</p>Formule :C11H14Cl2N2Degré de pureté :Min. 95%Masse moléculaire :245.15 g/mol3-Chloro-N-methylpropan-1-amine HCl
CAS :<p>Please enquire for more information about 3-Chloro-N-methylpropan-1-amine HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C4H11Cl2NDegré de pureté :Min. 95%Masse moléculaire :144.04 g/mol[2-(1,2,6-Trimethyl-1H-indol-3-yl)ethyl]amine hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about [2-(1,2,6-Trimethyl-1H-indol-3-yl)ethyl]amine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H18N2Degré de pureté :Min. 95%Masse moléculaire :202.3 g/mol[1-(2-Chlorobenzyl)-1H-benzimidazol-2-yl]methanol
CAS :Produit contrôlé<p>Please enquire for more information about [1-(2-Chlorobenzyl)-1H-benzimidazol-2-yl]methanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C15H13ClN2ODegré de pureté :Min. 95%Masse moléculaire :272.73 g/mol(4-Chloro-3-(methoxycarbonyl)phenyl)boronic acid
CAS :<p>Please enquire for more information about (4-Chloro-3-(methoxycarbonyl)phenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H8BClO4Degré de pureté :Min. 95%Masse moléculaire :214.41 g/molPipradrolHydrochloride
CAS :Produit contrôlé<p>Pipradrol Hydrochloride is a nonsteroidal anti-inflammatory drug (NSAID) that has been clinically used to treat symptoms of infectious diseases, autoimmune diseases and inflammatory diseases. It is a prodrug that is hydrolyzed to the active form, pipradrol in the body. Pipradrol Hydrochloride inhibits the cyclooxygenase enzymes COX 1 and COX 2, which are responsible for the formation of prostaglandins from arachidonic acid. Prostaglandins are involved in pain and inflammation. Pipradrol Hydrochloride has been shown to have an inhibitory effect on institutionalized geriatric patients with psychotic depression or depression.</p>Formule :C18H22ClNODegré de pureté :Min. 95%Masse moléculaire :303.83 g/molDidecyl dimethyl ammonium chloride - 80% aqueous solution
CAS :<p>Didecyl dimethyl ammonium chloride is a quaternary ammonium compound that has been shown to have a broad-spectrum antimicrobial activity. It has been used in disinfectants and as an active ingredient in pharmaceuticals, cosmetics, and foods. The compound is not toxic to humans or animals at concentrations up to 50%. Didecyl dimethyl ammonium chloride has been shown to be effective against infectious diseases caused by bacteria, viruses, fungi, and protozoa. This compound also has an effect on the epithelial-mesenchymal transition (EMT) process. Didecyl dimethyl ammonium chloride can be prepared by titration calorimetry or analytical method. The preparation of didecyl dimethyl ammonium chloride can be done using chloroform and benzalkonium chloride or glycol ether.</p>Formule :C22H48ClNCouleur et forme :Clear LiquidMasse moléculaire :362.08 g/mol2-Chloro-1-(1,2-dimethyl-1H-indol-3-yl)ethanone
CAS :Produit contrôlé<p>Please enquire for more information about 2-Chloro-1-(1,2-dimethyl-1H-indol-3-yl)ethanone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H12ClNODegré de pureté :Min. 95%Masse moléculaire :221.68 g/mol(17R)-4-Chloro-5-ethyl-9-fluoro-11b-hydroxy-16b-methylspiro[androsta-1,4-diene-17,2(3H)-furan]-3,3-dione
CAS :<p>Clobetasol propionate is an organic acid with a chemical structure that is stable in pharmaceutical preparations. It is used to treat inflammatory skin disorders such as psoriasis and atopic dermatitis. Clobetasol propionate is an impurity of clobetasol, which has been shown to be chemically stable in preparations. The clobetasol propionate compound has been found to be more potent than other topical corticosteroids for the treatment of plaque psoriasis and atopic dermatitis.</p>Formule :C25H30ClFO4Degré de pureté :Min. 95%Masse moléculaire :448.95 g/mol2,4-Dinitrobenzenesulfonyl chloride
CAS :<p>2,4-Dinitrobenzenesulfonyl chloride is a chemical reagent that is used in analytical chemistry. It reacts with pyrazole rings to form 2-aminopyridine derivatives. The reaction can be enhanced by adding metal ions such as copper(II) or zinc(II). 2,4-Dinitrobenzenesulfonyl chloride is also used in the solid-phase synthesis of heterocycles and in the synthesis of pharmaceuticals. The compound has been shown to react with human serum and form an unstable intermediate that undergoes hydrolysis to produce sulfate ion and trifluoroacetic acid. This reaction mechanism can be applied to other nucleophilic compounds such as bromide ion. 2,4-Dinitrobenzenesulfonyl chloride reacts with the amine group of proteins using the S N 1 mechanism. The resulting product is a chlorinated amino acid derivative which exhibits fluorescence properties when reacted with</p>Formule :C6H3ClN2O6SDegré de pureté :Min. 95%Masse moléculaire :266.62 g/mol2,3,7,8-Tetrachlorodibenzofuran
CAS :<p>2,3,7,8-Tetrachlorodibenzofuran (2,3,7,8-TCDF) is a congener of polychlorinated dibenzo-p-dioxin. It is found in the environment as a byproduct from the manufacture of chlorophenols and pentachlorophenol. 2,3,7,8-TCDF is an endocrine disruptor that affects cell nuclei and causes oxidative stress to the liver. There are few studies on 2,3,7,8-TCDF because it is not commercially available for use in research or industry. The only study done on this chemical found that it was potent inducer of glucuronide conjugation enzymes and decreased the activity of rat liver microsomes.</p>Formule :C12H4Cl4ODegré de pureté :Min. 95%Masse moléculaire :305.97 g/mol2-Amino-5,6-dichlorobenzothiazole
CAS :<p>2-Amino-5,6-dichlorobenzothiazole is an aminobenzothiazole derivative that has been shown to have antibacterial activity. It is a hydrophobic molecule with a skeleton consisting of alternating amines and carboxylic acids. 2-Amino-5,6-dichlorobenzothiazole binds to the fatty acid ester component of bacterial cell walls by hydrogen bonding or ionic interactions, disrupting the integrity of the cell wall and inhibiting the growth of bacteria. 2-Amino-5,6-dichlorobenzothiazole can be used to decolorize dyes and textiles that have been stained by oily materials. It is also used as a surfactant in personal care products such as shampoos and conditioners.</p>Formule :C7H4Cl2N2SDegré de pureté :Min. 95%Masse moléculaire :219.09 g/molBis(pentamethylcyclopentadienyl)hafniumdichloride
CAS :Produit contrôlé<p>Bis(pentamethylcyclopentadienyl)hafniumdichloride (BPMC-HfCl2) is an enantioselective catalyst that is used in organic synthesis. The catalyst converts unsaturated alkyl groups, halogen compounds and quinoline derivatives to their corresponding β-amino acid analogs. BPMC-HfCl2 can also be used to synthesize glycol ethers from ethyl alcohol and ethylene glycol. The catalyst has been shown to be stable in the presence of a cationic surfactant and β-amino acid, which are common substrates for the reaction.</p>Formule :C20H30Cl2HfDegré de pureté :Min. 95%Masse moléculaire :519.85 g/molB-Chlorocatecholborane
CAS :<p>B-chlorocatecholborane is a nonpolar solvent that is used in the synthesis of drugs and other organic compounds. It reacts with trifluoromethanesulfonic acid to form a coordination complex, which can be used to synthesize pharmaceuticals. B-chlorocatecholborane can also be used for solid-phase synthesis, which offers an efficient method for chemical reactions. This reagent has been shown to react with 5-hydroxytryptamine 4 (5-ht4) receptor, which is involved in the regulation of appetite and sleep. It also reacts with 2-arachidonoylglycerol (2AG), a lipid molecule that mediates the effects of cannabis on appetite, pain and memory. The structure of this compound was determined using nuclear magnetic resonance spectroscopy and mass spectrometry. The biological properties of B-chlorocatecholborane have not yet been studied.</p>Formule :C6H4BClO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :154.36 g/mol4-Chloro-3-(trifluoromethoxy)aniline
CAS :<p>Please enquire for more information about 4-Chloro-3-(trifluoromethoxy)aniline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C7H5ClF3NODegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :211.57 g/mol1-Bromo-4-nitrobenzene
CAS :<p>1-Bromo-4-nitrobenzene is a bromonitrile that is used to synthesize optical sensors. It is an intermediate in the synthesis of 1,5-dibromo-4-nitrobenzane, which was used as a model system for the reaction mechanism of coupling reactions. The coupling of 1-bromo-4-nitrobenzane with hydrochloric acid and palladium catalysts leads to the formation of a diazonium salt. This reaction can be analyzed by looking at the nitro group and the halides in the molecule. The nitro group reacts with ammonia to form an aminonitrile and water. Halides react with ammonia to form ammonium salts and hydrogen halides. Diazonium salts are then generated by adding nitrous acid (HNO2) or hydroxylamine (NHOH) to these compounds. Finally, transfer reactions are carried out by heating 1</p>Formule :C6H4BrNO2Degré de pureté :Min. 95%Masse moléculaire :202.01 g/mol(2S,3S)-5-[2-(Dimethylamino)ethyl]-3-hydroxy-2-(4-methoxyphenyl)-2,3-dihydro-1,5-benzothiazepin-4-one hydrochloride
CAS :<p>(2S,3S)-5-[2-(Dimethylamino)ethyl]-3-hydroxy-2-(4-methoxyphenyl)-2,3-dihydro-1,5-benzothiazepin-4-one hydrochloride is a racemic mixture of two enantiomers. It is a prodrug that is hydrolyzed to its active form, diltiazem. The drug has been shown to be effective in the treatment of hypertension and angina pectoris. (2S,3S)-5-[2-(Dimethylamino)ethyl]-3-hydroxy-2-(4-methoxyphenyl)-2,3-dihydro-1,5-benzothiazepin-4-one hydrochloride has been shown to inhibit the activity of the enzyme phosphodiesterase which breaks down cyclic AMP. This inhibition results in an increase in levels of</p>Formule :C20H24N2O3S·HClDegré de pureté :Min. 95%Masse moléculaire :408.94 g/molN,N'-Dimethylhydrazine dihydrochloride
CAS :Produit contrôlé<p>N,N'-Dimethylhydrazine dihydrochloride (DMHD) is a nonsteroidal anti-inflammatory drug that inhibits the production of prostaglandins by blocking cyclooxygenase-2 (COX-2). It works by inhibiting tumor growth and inducing apoptosis. DMHD has been shown to inhibit angiogenesis and induce apoptosis in liver cells. DMHD also inhibits the mitochondrial membrane potential, which is important for regulating cell function. The molecular docking analysis has shown that DMHD binds to COX-2 protein with high affinity and specificity. DMHD also inhibits fatty acid synthesis, which may be due to its inhibition of mitochondrial beta-oxidation enzymes. DMHD has been shown to have toxic effects on colon cells in rats. This agent can cause damage to the colon lining through a number of mechanisms, including causing DNA damage and increasing oxidative stress.</p>Formule :C2H8N2Degré de pureté :Min. 95%Masse moléculaire :60.1 g/mol2-[(N,N-Dibenzylamino)methyl]cyclohexanone hydrochloride
CAS :<p>Please enquire for more information about 2-[(N,N-Dibenzylamino)methyl]cyclohexanone hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H26ClNODegré de pureté :Min. 95%Masse moléculaire :343.89 g/mol2-Bromo-4'-nitroacetophenone
CAS :<p>2-Bromo-4'-nitroacetophenone is a chemical compound that has been shown to be active in enzyme inhibition experiments. It has been found to inhibit the activity of histidine decarboxylase, which catalyzes the conversion of histidine to histamine, and uv absorption. 2-Bromo-4'-nitroacetophenone binds to the active site of P450 enzymes, inhibiting their catalytic activity. This compound also inhibits fatty acid oxidation by binding to fatty acid hydroxylase and hydrogen bonds with tyrosine residues in proteins. 2-Bromo-4'-nitroacetophenone is structurally similar to 2-bromoacetophenone, which has been shown to have antihistaminic properties.</p>Formule :C8H6BrNO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :244.04 g/molMagnesium perchlorate
CAS :<p>Magnesium perchlorate is a magnesium salt of perchloric acid. It is a metal chelate that has been reported to be used for detecting water vapor in the atmosphere, and as an electrolyte in electrochemical impedance spectroscopy. Magnesium perchlorate has also been used as a catalyst in chemical reactions. It has a redox potential of -2.8 V and can be used as an oxidizing agent at lower temperatures. In addition, it is sensitive to hydrogen bonding with amines, which can be used for detection purposes.</p>Formule :Cl2MgO8Degré de pureté :Min. 95%Masse moléculaire :223.21 g/mol2'-Chloro-2-bromoacetophenone
CAS :<p>2'-Chloro-2-bromoacetophenone is a compound that belongs to the class of methyl ketones. It is known to have a high transfer hydrogenation activity and has been used in the synthesis of phenacyl, which is an important biomolecular. It also has a low toxicity and does not irritate skin or mucous membranes. 2'-Chloro-2-bromoacetophenone can be used as an antiarrhythmic agent for respiratory disorders. This compound can be used for formylation reactions, such as those found in microbial metabolism, due to its ability to transfer hydrogen from organic compounds.</p>Formule :C8H6BrClODegré de pureté :Min. 95%Masse moléculaire :233.49 g/molBis(ethylcyclopentadienyl)hafniumdichloride
CAS :Produit contrôlé<p>Please enquire for more information about Bis(ethylcyclopentadienyl)hafniumdichloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C14H18Cl2HfDegré de pureté :Min. 95%Masse moléculaire :435.69 g/mol2-Bromobenzofuran
CAS :<p>2-Bromobenzofuran is a compound that has been shown to have antioxidant properties and can be used for the treatment of chronic kidney disease, hepatitis, and degenerative diseases. It has nitrogen atoms in its structure that are reactive with oxygen, which may cause the release of picolinic acid (PA), a compound that has been shown to have anti-inflammatory properties. 2-Bromobenzofuran is an alkynyl group that binds to receptors such as serotonin and dopamine. This group also has carbonyl groups, which can form adducts with amines. The piperazine ring in 2-bromobenzofuran is activated by reaction with hydroxyl groups.</p>Formule :C8H5BrODegré de pureté :Min. 95%Masse moléculaire :197.03 g/mol1,1-Dichlorodimethyl ether
CAS :<p>1,1-Dichlorodimethyl ether is a chemical compound that is used as an intermediate in the synthesis of trifluoroacetic acid from hydrochloric acid and methanol. This chemical has also been shown to inhibit inflammation by inhibiting the release of inflammatory cytokines, including epidermal growth factor (EGF) and interleukin-8 (IL-8). It may be used to treat chronic cough and chronic bronchitis. 1,1-Dichlorodimethyl ether inhibits the production of EGF by blocking the binding of EGF to its receptor on the surface of cells. The molecule also has an inhibitory effect on IL-8 production via inhibition of protein kinase C. The 1,1-dichlorodimethyl group is a reactive oxygen species that can react with other molecules such as DNA or proteins, leading to damage or even cell death.</p>Formule :C2H4Cl2ODegré de pureté :Min. 95%Masse moléculaire :114.96 g/mol3-Cyano-1-azetidinesulfonyl chloride
CAS :<p>Please enquire for more information about 3-Cyano-1-azetidinesulfonyl chloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C4H5ClN2O2SDegré de pureté :Min. 95%Masse moléculaire :180.61 g/molN-(2-Benzoyl-4-chlorophenyl)-2-chloro-N-methylacetamide
CAS :<p>Please enquire for more information about N-(2-Benzoyl-4-chlorophenyl)-2-chloro-N-methylacetamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H13Cl2NO2Degré de pureté :Min. 95%Masse moléculaire :322.19 g/mol2,4-Dibromobutyryl chloride
CAS :<p>2,4-Dibromobutyryl chloride is an enantiopure compound that can be used as a chemical building block in the synthesis of many other chemical compounds. It has been shown to have butyric acid mediated effects on diabetes and the condition of the esters. 2,4-Dibromobutyryl chloride has also been shown to have stereoselective effects on glucokinase and ketones.</p>Formule :C4H5Br2ClODegré de pureté :90%MinMasse moléculaire :264.34 g/mol2,4-Dichloro-5-trifluoromethylpyrimidine
CAS :<p>2,4-Dichloro-5-trifluoromethylpyrimidine is a synthetic compound that can be used as an additive in plastics and cellulose. It is also used to produce 2,4-dichloro-5-(trifluoromethyl)pyrimidine, which has been shown to inhibit the growth of cancer cells. The methylating properties of 2,4-dichloro-5-(trifluoromethyl)pyrimidine have been shown to be useful for the production of amines. This chemical can also be used as a solvent due to its low boiling point.</p>Formule :C5HCl2F3N2Degré de pureté :Min. 95%Couleur et forme :Clear Colourless To Pale Yellow To Brown LiquidMasse moléculaire :216.98 g/mol2-Chloro-1-(5-methoxy-1,2-dimethyl-1H-indol-3-yl)ethanone
CAS :Produit contrôlé<p>Please enquire for more information about 2-Chloro-1-(5-methoxy-1,2-dimethyl-1H-indol-3-yl)ethanone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H14ClNO2Degré de pureté :Min. 95%Masse moléculaire :251.71 g/mol3-(6-Chloro-1-isopropyl-1H-benzimidazol-2-yl)propanoic acid
CAS :Produit contrôlé<p>Please enquire for more information about 3-(6-Chloro-1-isopropyl-1H-benzimidazol-2-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H15ClN2O2Degré de pureté :Min. 95%Masse moléculaire :266.72 g/mol5-Oxo Rosuvastatin
CAS :<p>5-Oxo Rosuvastatin is a drug product that has been synthesized from natural ingredients. It is an analytical standard for the impurity, 5-oxo-rosuvastatin, which is a potential impurity in the API, rosuvastatin. This drug product has been custom synthesized in order to provide an Impurity Standard for HPLC. This drug product is also used as a Synthetic Reference Standard for Drug Development and Research and Development.</p>Formule :C22H26FN3O6SDegré de pureté :Min. 95%Couleur et forme :Off-White To Light (Or Pale) Yellow To Dark Yellow SolidMasse moléculaire :479.52 g/molMethyl 3-amino-5-fluoro-1-methyl-1H-indole-2-carboxylate
CAS :Produit contrôlé<p>Please enquire for more information about Methyl 3-amino-5-fluoro-1-methyl-1H-indole-2-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H11FN2O2Degré de pureté :Min. 95%Masse moléculaire :222.22 g/molEpichlorohydrine
CAS :<p>Epichlorohydrine is a chemical compound that binds to calcium and sodium ions. It is used in wastewater treatment, where it reacts with fatty acids to form epoxides. Epichlorohydrine has been shown to have carcinogenic effects in animals and humans, which are due to its genotoxic properties. The carcinogenic properties of epichlorohydrine can be attributed to the formation of reactive oxygen species, such as hydroxyl radicals and hydrogen peroxide, which cause DNA damage. Epichlorohydrine also has photosynthetic activity when exposed to sunlight or ultraviolet light.</p>Formule :C3H5ClODegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :92.52 g/mol4-Bromofuran-2-carbaldehyde
CAS :<p>4-Bromofuran-2-carbaldehyde is a synthetic compound that has been shown to have antioxidant properties. It contains an electron-donating carbonyl group and an electron-withdrawing bromine atom. 4-Bromofuran-2-carbaldehyde is useful in the treatment of endophytic fungi infections, as it inhibits the synthesis of ergosterol, which is an important component of the fungal cell membrane. The molecule's conformational properties are also important for its biological activity, as they enable it to act as a chiral ligand by binding to proteins in a way that will inhibit their function. In addition, 4-bromofuran-2-carbaldehyde has been shown to be effective against cancer cells in vitro, particularly against MMCF7 cells. This may be due to its ability to bind to DNA and prevent transcription or replication of DNA strands.</p>Formule :C5H3BrO2Degré de pureté :Min. 95%Masse moléculaire :174.98 g/molCyclopropyl 2-fluorobenzyl ketone
CAS :<p>Cyclopropyl 2-fluorobenzyl ketone is an inhibitor that blocks the production of cyclic nucleotides and thereby inhibits the activity of the enzyme phosphodiesterase. It has been shown to inhibit platelets and inhibit the metabolic rate in rats. The drug also has a cytotoxic effect on rat liver cells, which may be due to its ability to bind hydrogen bonds. Cyclopropyl 2-fluorobenzyl ketone has been found to have a strong inhibitory effect on ticagrelor, statins, and anti-platelet agents. This drug has also shown a potential for adverse drug interactions with other biological products such as erythropoietin, insulin, or heparin.</p>Degré de pureté :Min. 95%3-(Trifluoromethyl)benzyl chloride
CAS :<p>3-(Trifluoromethyl)benzyl chloride is a chloromethylating agent that reacts with magnesium to form a magnesium chloride solution. 3-(Trifluoromethyl)benzyl chloride is also used in the synthesis of pharmaceuticals, pesticides, and dyes. The reaction produces small amounts of chlorinated byproducts such as chloride, which can be found in wastewater. This chemical has been shown to have adverse effects on the environment through its release into waterways or the atmosphere.</p>Formule :C8H6ClF3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :194.58 g/mol2-(Trifluoromethyl)pyridin-3-amine
CAS :<p>2-(trifluoromethyl)pyridin-3-amine is an industrial chemical that is used as a reagent in the synthesis of other chemicals. It is synthesized from benzene and an acid ethyl ester in a complex reaction. 2-(trifluoromethyl)pyridin-3-amine is toxic, with industrial uses such as the synthesis of dyes and pesticides.</p>Formule :C6H5F3N2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :162.11 g/molStannous chloride anhydrous
CAS :<p>Stannous chloride anhydrous is a particle with a particle size of 3-6 microns and a melting point of 8°C. It has been shown in toxicity studies to be non-toxic to rats and rabbits when administered orally. Stannous chloride anhydrous is a coordination compound that contains stannous ion, which is coordinated by four sulfur atoms and two nitrogen atoms. The molecule can also have different geometries depending on the solvent used; for example, in trifluoroacetic acid, it adopts a trigonal bipyramidal geometry. Stannous chloride anhydrous has been shown to inhibit enzymes such as pepsin, chymotrypsin, and trypsin. This inhibition may be due to its ability to bind covalently with these enzymes.</p>Formule :Cl2SnDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :189.62 g/mol3-(Difluoromethoxy)benzaldehyde
CAS :<p>Please enquire for more information about 3-(Difluoromethoxy)benzaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H6F2O2Degré de pureté :Min. 95%Masse moléculaire :172.13 g/mol2-Fluoro-4-hydroxybenzaldehyde
CAS :<p>2-Fluoro-4-hydroxybenzaldehyde is an oxidative compound that is a model compound of phenolic compounds. It can be used to synthesize 2,6-dichloroquinone and 2,5,7,8-tetrachlorodibenzo[p]fluoranthene. The metabolic pathway for this compound starts with the oxidative decarboxylation of L-tyrosine to form 4-hydroxyphenylpyruvic acid. This compound is then oxidized by cytochrome P450 enzymes to form 4-(2'-oxo)phenol. The 4-(2'-oxo)phenol can be methylated by S-adenosylmethionine in order to form 2-fluoro-4-hydroxybenzaldehyde.</p>Formule :C7H5FO2Degré de pureté :Min. 95%Masse moléculaire :140.11 g/molHexadecafluoro(1,3-dimethylcyclohexane)
CAS :Produit contrôlé<p>Ternary mixtures of hexadecafluoro(1,3-dimethylcyclohexane) with fluorine and hydrogen fluoride are stable compounds. The proton is a constant, which is the only variable in the equation. The analytical method for determining the amount of hexadecafluoro(1,3-dimethylcyclohexane) in a mixture can be found in reference 1. This reference also discusses the matrix effect on this compound's stability and optical properties. Reference 2 discusses transfer reactions that are present when hexadecafluoro(1,3-dimethylcyclohexane) is heated to temperatures of 400°C or above. Reference 3 discusses how polymer films can be formed by heating hexadecafluoro(1,3-dimethylcyclohexane) with a solvent such as pentane. Reference 4 discusses how covid-19 pandemic has been shown to be effective against the H2 strain of subt</p>Formule :C8F16Degré de pureté :Min. 95%Masse moléculaire :400.06 g/mol[(4-Methyl-1H-imidazol-5-yl)methyl]amine hydrochloride
CAS :<p>Please enquire for more information about [(4-Methyl-1H-imidazol-5-yl)methyl]amine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C5H9N3Degré de pureté :Min. 95%Masse moléculaire :111.15 g/molBromosuccinic acid
CAS :<p>Bromosuccinic acid is a type of organic compound with the chemical formula HOCCH=CHOH. It is an ester that contains a hydroxyl group, a carboxylic acid group, and a bromine atom. Bromosuccinic acid has been shown to have biocompatible properties and can be used as a polymer for biomedical applications. It also has the ability to form covalent bonds with basic proteins due to its hydroxyl group, which is important for protein stability. Bromosuccinic acid has been shown to inhibit trypsin activity in soybean trypsin, which may be due to its disulfide bond or low energy content. This substance also reacts with malonic acid and carbonic acid, producing galacturonic acid and fatty acids respectively. Bromosuccinic acid is produced by bacteria of the genus Enterobacteriaceae and belongs to the family of short-chain fatty acids.</p>Degré de pureté :Min. 95%Ethyl 5-chloro-1,3-dimethyl-1H-indole-2-carboxylate
CAS :Produit contrôlé<p>Please enquire for more information about Ethyl 5-chloro-1,3-dimethyl-1H-indole-2-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H14ClNO2Degré de pureté :Min. 95%Masse moléculaire :251.71 g/molMethyl 2,6-difluoronicotinate
CAS :<p>Methyl 2,6-difluoronicotinate is a regioselective dopamine receptor antagonist. It is a carboxylic acid that reacts with esters to form a nucleophilic anion. Methyl 2,6-difluoronicotinate has been shown to be an effective dopamine D2 receptor antagonist in rats and monkeys. This drug was also able to inhibit the binding of dopamine to the D3 receptor in rat striatal synaptosomes. The regioselectivity of this drug allows for preferential binding at the D2 receptor over other sites such as the D1 or D4 receptors.</p>Formule :C7H5F2NO2Degré de pureté :Min. 95%Masse moléculaire :173.12 g/mol7-Bromobenzo[d]oxazole
CAS :<p>Please enquire for more information about 7-Bromobenzo[d]oxazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C7H4BrNODegré de pureté :Min. 95%Masse moléculaire :198.02 g/molN,N,N-Trimethyl-1-decanaminium bromide
CAS :<p>N,N,N-Trimethyl-1-decanaminium bromide is a quaternary ammonium salt with the chemical formula CH3(CH2)5COOB. It is an ionic surfactant that is used as an emulsifier for water and oil based systems. N,N,N-Trimethyl-1-decanaminium bromide has been shown to be able to stabilize the surface tension in aqueous solutions and can be used in biomedical research. This compound also has the ability to bind proteins and other organic molecules. N,N,N-Trimethyl-1-decanaminium bromide may be used as a fluorescent probe for detecting hydrophobic effects in biological systems.</p>Formule :C13H30NBrDegré de pureté :Min. 95%Masse moléculaire :280.29 g/mol1,3-Dibromoacetone
CAS :<p>1,3-Dibromoacetone (1,3-DB) is a chemical compound that is used in analytical chemistry to separate peptides and proteins by hydrophilic interaction chromatography. 1,3-DB reacts with the cysteine residues in the protein to form a disulfide bond. The complex formed can be detected using a fluorescent dye such as fluorescein. This compound has been used to characterize the urine samples of patients with α subunit amyloidosis who have increased levels of adenine nucleotides. It has also been used for detection sensitivity testing for the histidine residues on the enzyme synthetase and subunits of streptavidin.</p>Formule :C3H4Br2ODegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :215.87 g/mol4,7-Diazaspiro[2.5]octane dihydrochloride
CAS :<p>Please enquire for more information about 4,7-Diazaspiro[2.5]octane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%[(4-Methyl-1,3-thiazol-2-yl)methyl]amine dihydrochloride
CAS :<p>Please enquire for more information about [(4-Methyl-1,3-thiazol-2-yl)methyl]amine dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C5H8N2SDegré de pureté :Min. 95%Masse moléculaire :128.2 g/mol2,2-Bis(4-hydroxyphenyl)-1,1,1-trichloroethane
CAS :<p>2,2-Bis(4-hydroxyphenyl)-1,1,1-trichloroethane is an analytical method that is used to measure the estrogenic activity of a chemical. It is also known as methoxychlor and can be used for the analysis of natural compounds. 2,2-Bis(4-hydroxyphenyl)-1,1,1-trichloroethane binds to the estrogen receptor and mimics its effects. This compound was shown to have high values in surface methodology and in vitro assays.</p>Formule :C14H11Cl3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :317.59 g/mol2-Amino-3',4'-dimethoxypropiophenone hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about 2-Amino-3',4'-dimethoxypropiophenone hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H16ClNO3Degré de pureté :Min. 95%Masse moléculaire :245.7 g/mol17b-Acetoxy 6b-hydroxy Trichloropyridyltentagel
Produit contrôlé<p>Please enquire for more information about 17b-Acetoxy 6b-hydroxy Trichloropyridyltentagel including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-Leu-2-chlorotrityl resin
CAS :<p>Please enquire for more information about H-Leu-2-chlorotrityl resin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Fluorescein disodium salt
CAS :<p>Fluorescein sodium is a fluorescent dye that is used in a wide variety of applications, including fluorescence angiography, histology, and immunohistochemistry. Fluorescein sodium binds to the receptor binding sites of proteins and cells, which then emit light when excited by a laser. It is also used in asthma therapy to assess lung function and for process optimization in industries where fluorescence detectors are used. This substance has been shown to be effective for the treatment of proliferative diabetic retinopathy in both diabetic patients and animals. Fluorescein sodium can cause allergic reactions and chemical reactions if it comes into contact with skin or mucous membranes.</p>Formule :C20H10O5·2NaDegré de pureté :Min. 95%Couleur et forme :Red PowderMasse moléculaire :376.28 g/mol7-Hydroxy granisetron hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about 7-Hydroxy granisetron hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H25ClN4O2Degré de pureté :Min. 95%Masse moléculaire :364.87 g/molPiperidin-3-one hydrochloride
CAS :<p>Piperidin-3-one hydrochloride is an organic solvent that belongs to the group of benzyl compounds. It is a reagent for the synthesis of sulfides, which are used in the production of dyes, pharmaceuticals, and other products. Piperidin-3-one hydrochloride can be used as a constant in calculating the shift of tetrafluoroborate ions. This compound has been shown to be assembled into planar structures with six atoms per side. The resonance frequencies of this compound depend on the solvents and its aliphatic nature. Piperidin-3-one hydrochloride can be used to generate dimethyl sulfide by reacting with methanol or methyl chloride.</p>Formule :C5H10NOClDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :135.59 g/mol2-Chloro-2',4'-difluoroacetophenone
CAS :<p>2-Chloro-2',4'-difluoroacetophenone (2,4-DFAP) is an asymmetric synthesis of urea nitrogen. It has been shown to be a broad-spectrum antimicrobial, with activity against a number of fungi and bacteria. The molecular modelling of 2,4-DFAP has revealed that it has intramolecular hydrogen bonds and is a supramolecular enantiomer. Additionally, the transport properties have been studied and found to have chloride ions in the molecule. This may be responsible for its anti-fungal effects as well as its ability to inhibit the growth of cryptococcus neoformans.</p>Formule :C8H5ClF2ODegré de pureté :Min. 95%Masse moléculaire :190.57 g/molEthyl 2-[bis(2,2,2-trifluoroethyl)phosphono]propionate
CAS :<p>Please enquire for more information about Ethyl 2-[bis(2,2,2-trifluoroethyl)phosphono]propionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C9H13F6O5PDegré de pureté :Min. 95%Masse moléculaire :346.16 g/mol4-Ethyl-5-fluoropyrimidine
CAS :<p>4-Ethyl-5-fluoropyrimidine is a white solid with a melting point of 258°C. It is soluble in organic solvents such as acetonitrile and methanol. The compound has been shown to have reversed phase chromatographic properties and can be used as a potential impurity in the synthesis of other compounds. 4-Ethyl-5-fluoropyrimidine is not susceptible to photolytic decomposition but can be oxidized by air, which may result in the formation of impurities. 4-Ethyl-5-fluoropyrimidine can be purified using chromatography methods with high sensitivity and low detection limits. The compound has also been shown to have good chemical stability under ambient conditions, making it suitable for storage or shipping.</p>Formule :C6H7FN2Degré de pureté :Min. 95%Masse moléculaire :126.13 g/molAcridine orange hydrochloride hydrate
CAS :<p>Acridine orange hydrochloride hydrate is a fine chemical that can be used as a reagent or building block in research and other chemical reactions. It is used as a speciality chemical with CAS number 1704465-79-1. Acridine orange hydrochloride hydrate has versatile applications and is used as a reaction component or intermediate. Acridine orange hydrochloride hydrate is also useful as a scaffold to make complex compounds.</p>Formule :C17H19N3·HCl·xH2ODegré de pureté :Min. 98 Area-%Couleur et forme :Orange PowderMasse moléculaire :301.8116a-Bromodehydro epiandrosterone
CAS :Produit contrôlé<p>Please enquire for more information about 16a-Bromodehydro epiandrosterone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H27BrO2Degré de pureté :Min. 95%Masse moléculaire :367.32 g/mol3,3-Difluoropentanedioic Acid
CAS :<p>3,3-Difluoropentanedioic Acid is a reagent that is used in organic chemistry. It can be hydrolyzed to give 3,3-difluoro-1,2-propanediol. This chemical reacts with dithianes to give 1,2-dithiane and quantitatively produces 3-fluoro-1,2-propanediol. It is an ester of 3,3-difluoropentanedioic acid and has been shown to have antiinflammatory properties in rats.</p>Formule :C5H6F2O4Degré de pureté :Min. 95%Masse moléculaire :168.1 g/molrac 1,2-dioleoyl-3-chloropropanediol
CAS :<p>Rac-1,2-dioleoyl-3-chloropropanediol is a fatty acid and can be used for the preparation of isotopically labelled fatty acids. Rac-1,2-dioleoyl-3-chloropropanediol has been used as an internal standard in the quantification of fatty acid esters in plant oils. The use of rac 1,2-dioleoyl-3-chloropropanediol was found to be appropriate for calibrating liquid chromatography with a quadrupole mass spectrometer.</p>Formule :C39H71ClO4Degré de pureté :Min. 95%Masse moléculaire :639.43 g/mol2-Methyl-4-chlorophenoxyacetic acid
CAS :<p>2-Methyl-4-chlorophenoxyacetic acid is a sodium salt of 2-methyl-4-chlorophenoxyacetic acid. It is a herbicide that inhibits photosynthesis by disrupting the electron transport chain in chloroplasts. The hydroxyl group on the phenoxy ring is responsible for its herbicidal activity. 2-Methyl-4-chlorophenoxyacetic acid has been shown to cause significant cell death in tissue culture, which may be due to its ability to inhibit enzymes such as acetylcholinesterase, phosphodiesterase, and carboxypeptidase A2. This chemical also has carcinogenic potential, but no toxicological studies have been conducted in humans or animals.</p>Formule :C9H9ClO3Degré de pureté :Min. 95%Masse moléculaire :200.62 g/mol4-Amino-3,5-difluorobenzoic Acid
CAS :<p>4-Amino-3,5-difluorobenzoic Acid is a chemical compound that is used to manufacture dyes and pharmaceuticals. It is prepared by the reaction of dimethyl formamide with bromobenzoate and hydrobromic acid. The reaction product is decompressed to remove the toxic hydrogen cyanide gas and then reacted with sodium borohydride in liquid ammonia. This process yields 4-amino-3,5-difluorobenzoic acid which can be purified by recrystallization from water or chloroform.</p>Formule :C7H5F2NO2Degré de pureté :Min. 95%Masse moléculaire :173.12 g/molIron bis(tetrafluoroborate) hexahydrate
CAS :<p>Iron bis(tetrafluoroborate) hexahydrate is a ferrimagnetic, thermally stable coordination compound that has been shown to interact with bidentate ligands. Iron bis(tetrafluoroborate) hexahydrate can be used as a mononuclear section in analogy to the octahedral section of nickel bis(tetrafluoroborate) hexahydrate. The ligands are methyl groups, which are diffracted at 2θ values of 12.8° and 18.3°. The compound is stable in solvents such as dimethylsulfoxide and tetrahydrofuran. It also has chelate ligand transfer properties, which are due to the presence of two hydroxyl groups on each iron atom.</p>Formule :Fe(BF4)2•(H2O)6Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :337.55 g/molEthyl 1-benzyl-3-(4-bromophenyl)-1H-pyrazole-5-carboxylate
CAS :Produit contrôlé<p>Please enquire for more information about Ethyl 1-benzyl-3-(4-bromophenyl)-1H-pyrazole-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H17BrN2O2Degré de pureté :Min. 95%Masse moléculaire :385.25 g/mol2- (4-Iodophenoxy) - N, N- diethylethanamine
CAS :Produit contrôlé<p>Please enquire for more information about 2- (4-Iodophenoxy) - N, N- diethylethanamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H18INODegré de pureté :Min. 95%Masse moléculaire :319.18 g/molChromonar hydrochloride
CAS :<p>Chromonar hydrochloride is a non-steroidal anti-inflammatory drug that is used to treat the symptoms of bowel disease. It relieves pain and reduces inflammation by blocking the production of prostaglandins. Chromonar hydrochloride may also be used to reduce blood pressure and relieve chest pain caused by heart disease. It has been shown to have cardioprotective effects in experimental models. Chromonar hydrochloride is metabolized by cytochrome P450 enzymes, which are involved in the synthesis of proteins, as well as other enzymes that maintain the integrity of DNA and RNA molecules. Chromonar hydrochloride can also cause an allergic reaction if taken with nitrous oxide.</p>Formule :C20H28ClNO5Degré de pureté :Min. 95%Masse moléculaire :397.89 g/mol2-Fluoro-6-hydroxybenzonitrile
CAS :<p>2-Fluoro-6-hydroxybenzonitrile is a white crystalline solid that is soluble in water and ethanol. It hydrolyzes in aqueous solutions to form phenols, carboxylic acids and methoxybenzenes. 2-Fluoro-6-hydroxybenzonitrile may be used as an intermediate in the synthesis of other organic compounds.</p>Formule :C7H4FNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :137.11 g/molEthyl 5-bromo-2-methylnicotinate
CAS :<p>Ethyl 5-bromo-2-methylnicotinate is a crystalline compound that is extracted from the industrial process of synthetic organic solvents. The extraction of this compound can be done using an acetylation reaction with ammonium acetate. This chemical is then recrystallized to produce a large amount of pure product. The average yield for this chemical is around 60%.</p>Degré de pureté :Min. 95%6-Chloroindole-2-carboxylic acid
CAS :<p>6-Chloroindole-2-carboxylicacid is a potent inhibitor of β-lactamase enzymes. It has been shown to act as a competitive inhibitor with an affinity for the β-lactamase enzyme in the nanomolar range. 6-Chloroindole-2-carboxylicacid is also a potent compound that can be used in experiments and screening. It has been shown to bind to the β-lactamase enzyme, which inhibits its activity, leading to a decrease in fluorescence. 6-Chloroindole-2-carboxylicacid has also been shown to have an inhibitory effect on bacterial cells by inhibiting protein synthesis, DNA replication, and RNA transcription.</p>Formule :C9H6ClNO2Degré de pureté :95%NmrMasse moléculaire :195.6 g/mol2,6-Dibromophenol
CAS :<p>2,6-Dibromophenol is a chemical compound that is used as an analytical reagent in the determination of bromide ion concentrations. It can be prepared by the debromination of 2-bromophenols using hydrochloric acid and heating to 150°C. This reaction mechanism is best described by kinetic data and a model system. The reaction product of this process is 2,6-dibromo-3-hydroxyphenol. This compound has been shown to have a higher dry weight in strains with high levels of hydroxy group activity.</p>Formule :C6H4Br2ODegré de pureté :Min. 95%Masse moléculaire :251.9 g/mol4-(Trifluoromethyl)benzyl amine
CAS :<p>4-(Trifluoromethyl)benzyl amine is a nucleophilic reagent that is used for the asymmetric synthesis of chiral amines. The reaction mechanism involves the nucleophilic attack of the trifluoromethyl group on an electron-deficient carbon atom of a substrate, followed by elimination of hydrogen fluoride. The trifluoromethyl group also acts as a light emitter when irradiated with UV light. 4-(Trifluoromethyl)benzyl amine is able to produce carbonyl groups through irreversible oxidation and has been shown to inhibit cancer cell proliferation in vitro and in vivo. This compound can be found as white crystals and has a polymorphic nature.</p>Formule :C8H8F3NDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :175.15 g/mol1-(3-Bromophenyl)-piperazine
CAS :Produit contrôlé<p>1-(3-Bromophenyl)-piperazine is a furan compound with a piperazine base. It is used as an anti-cancer drug in the treatment of cancer and impurities are removed from this compound using chromatography. This compound has been shown to be homocoupled, which means that it can be used to synthesize other compounds. 1-(3-Bromophenyl)-piperazine is approved by the FDA and European Medicines Agency for the treatment of cancer, and has been shown to have immunological properties.</p>Formule :C10H13BrNDegré de pureté :Min. 95%Masse moléculaire :227.12 g/mol1-Chloro-2-(ethylthio)ethane
CAS :Produit contrôlé<p>1-Chloro-2-(ethylthio)ethane (1,2-ETE) is a reactive oxygen species that inhibits the electron transport chain in mitochondria. 1,2-ETE decreases the mitochondrial membrane potential and causes oxidative damage to proteins, such as recombinant cytochrome P450. 1,2-ETE has been shown to decrease photosynthetic activity by inhibiting the light reactions of photosynthesis. It also inhibits the electron transport chain in mitochondria and causes damage to cells by reacting with sulfide to form sulfhydryl compounds. The toxic effects of 1,2-ETE are due to its ability to cause injury by reacting with other molecules.</p>Formule :C4H9ClSDegré de pureté :Min. 95%Couleur et forme :Clear Colourless To Pale Yellow LiquidMasse moléculaire :124.63 g/mol2-Methyl-6-(trifluoromethyl)nicotinaldehyde
CAS :<p>Please enquire for more information about 2-Methyl-6-(trifluoromethyl)nicotinaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H6F3NODegré de pureté :Min. 95%Masse moléculaire :189.13 g/molN-Ethyl-1,1,2,2,3,3,4,4,5,5,6,6,6-tridecafluoro-N-(2-hydroxyethyl)Hexane-1-sulfonamide
CAS :<p>Please enquire for more information about N-Ethyl-1,1,2,2,3,3,4,4,5,5,6,6,6-tridecafluoro-N-(2-hydroxyethyl)Hexane-1-sulfonamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H10F13NO3SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :471.24 g/mol(S)-5,6,6a,7-Tetrahydro-6-methyl- 4H-dibenzo[de,g]quinoline-10,11-diol hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about (S)-5,6,6a,7-Tetrahydro-6-methyl- 4H-dibenzo[de,g]quinoline-10,11-diol hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C17H17NO2·HClDegré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :303.78 g/mol3,4-Difluorobenzyl amine
CAS :<p>3,4-Difluorobenzyl amine (3,4-DFBA) is a synthetic compound that has been shown to have anti-cancer properties. It has been used in the synthesis of perovskites as an alternative strategy for solar cell applications. 3,4-DFBA has also been used to investigate the effect of hydrophobic and deformation on the biological activity of amines. This compound inhibits aldehyde oxidase and catalase from glyoxal and hydrogen peroxide respectively, which may be due to its ability to form microcapsules with a diameter of less than 50 nm.</p>Formule :C7H7F2NDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :143.13 g/mol2-(Chloromethyl)-3-(2-methylphenyl)quinazolin-4(3H)-one
CAS :Produit contrôlé<p>Please enquire for more information about 2-(Chloromethyl)-3-(2-methylphenyl)quinazolin-4(3H)-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H13ClN2ODegré de pureté :Min. 95%Masse moléculaire :284.74 g/mol4-Nitrophenylhydrazine hydrochloride
CAS :<p>4-Nitrophenylhydrazine hydrochloride is an organic compound that belongs to the class of hydrazines. It is a colorless solid that has a melting point of 202-204 °C. 4-Nitrophenylhydrazine hydrochloride is used in the synthesis of other compounds, such as trifluoroacetic acid and nucleophilic compounds. The chemical structure can be analyzed using nuclear magnetic resonance (NMR) spectroscopy, which shows that this compound contains amines and nitro groups. 4-Nitrophenylhydrazine hydrochloride is also soluble in water due to its acidic nature. This compound reacts with bases and alcohols to form salts, such as monosodium salt.</p>Formule :C6H7N3O2·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :189.6 g/mol1H-Pyrazole-4-sulfonyl chloride
CAS :<p>1H-Pyrazole-4-sulfonyl chloride is a chemical compound that is used as a building block for the synthesis of other compounds. It is a versatile intermediate and can be used in many organic reactions such as condensation, cyclization, and oxidation. This chemical has been shown to have high quality and purity with no detectable impurities. 1H-Pyrazole-4-sulfonyl chloride can be used in research, manufacturing, or as a speciality chemical.</p>Formule :C3H3ClN2O2SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :166.59 g/molDoxorubicinol hydrochloride - Mixture of Diasteromers
CAS :<p>Please enquire for more information about Doxorubicinol hydrochloride - Mixture of Diasteromers including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C27H32ClNO11Degré de pureté :Min. 95%Masse moléculaire :582 g/molSilver tetrafluoroborate
CAS :<p>Silver tetrafluoroborate (AgBF) is a chemical reagent that is used in analytical chemistry and structural analysis. It has shown to be a stable complex with organic molecules, such as fatty acids, and has been used to study the properties of these compounds. AgBF is an inorganic salt that can be synthesized by reacting silver nitrate and barium fluoride in the presence of trifluoroacetic acid. This compound has also been found to form stable complexes with organic molecules containing a hydroxyl group or nitrogen atom. The structure of AgBF has been determined through X-ray crystal structures and electron diffraction patterns. The molecule consists of two symmetric chains joined by a central disulfide bond.</p>Formule :AgBF4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :194.67 g/moltrans-Heptachlor epoxide
CAS :<p>trans-Heptachlor epoxide is a pesticide that is used in agriculture and industry. It can be detected by various analytical methods, including mass spectrometry. The chemical structure of trans-heptachlor epoxide has been determined by mass spectrometric analysis. This compound has been found to exist as two stereoisomers, with the cis form being more stable than the trans form at ambient conditions. Magnetic resonance spectroscopy has been used to study the rotational motion of the hydrocarbon chain. Validation of analytical methods for this compound is necessary due to its limited availability and high reactivity with other compounds in the environment.</p>Formule :C10H5Cl7ODegré de pureté :Min. 95%Masse moléculaire :389.32 g/molBis(pyridine)iodonium tetrafluoroborate
CAS :<p>Bis(pyridine)iodonium tetrafluoroborate is a reagent that can be used to iodinate organic compounds. It is prepared by the reaction of pyridine with iodine and bromine in tetrafluoroboric acid. Bis(pyridine)iodonium tetrafluoroborate is an active compound that can be used for amino acid analysis, optical properties, and functional groups. This compound also can be used for magnetic resonance analysis, palladium-catalyzed coupling, and synthetic reactions. Bis(pyridine)iodonium tetrafluoroborate has been found to have radiation transport properties and a strong reactivity towards acids.</p>Formule :C10H10BF4IN2Degré de pureté :Min. 95%Masse moléculaire :371.91 g/molN-Acetyl-S-(1,2-dichloroethenyl)-L-cysteine
CAS :<p>N-Acetyl-S-(1,2-dichloroethenyl)-L-cysteine is a reactive compound that is formed from the metabolism of acetaminophen. It has been shown to cause oxidative injury in the mitochondria of proximal tubule cells. N-Acetyl-S-(1,2-dichloroethenyl)-L-cysteine disrupts mitochondrial membrane potential and causes ATP depletion. It also causes mitochondrial dysfunction by inhibiting respiratory chain activity and lowering cytosolic calcium levels. N-Acetyl-S-(1,2-dichloroethenyl)-L-cysteine has been shown to be toxic in animals and humans. The main analytical method used to detect this compound is the tetrazolium dye assay.</p>Formule :C7H9Cl2NO3SDegré de pureté :Min. 95%Masse moléculaire :258.12 g/molMethyl chlorooxoacetate
CAS :<p>Methyl chlorooxoacetate is an oxalyl ester that has been used for the synthesis of glycol esters. Methyl chlorooxoacetate has been shown to have a high solubility in water and organic solvents, which is desirable for industrial processes. This molecule also has the ability to be acylated with various organic groups and can act as a process-optimization agent in plant physiology. Methyl chlorooxoacetate binds as a receptor to growth factors and HIV infection, which leads to amide formation and carbonyl group formation.</p>Formule :C3H3ClO3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :122.51 g/molL-Alaninol-2-chlorotrityl resin
<p>Please enquire for more information about L-Alaninol-2-chlorotrityl resin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%4-(Trifluoromethoxy)aniline
CAS :<p>4-(Trifluoromethoxy)aniline is a reactive intermediate used in the synthesis of pharmaceuticals, dyes, and pesticides. It is prepared by reacting hydrogen fluoride with aniline in the presence of an acid catalyst. 4-(Trifluoromethoxy)aniline can be used to synthesize epoxyeicosatrienoic acids, which are potent anti-inflammatory agents. 4-(Trifluoromethoxy)aniline has been shown to have a pharmacokinetic profile that is similar to those of other fluoroquinolones, but has not been studied for clinical development.</p>Formule :C7H6F3NODegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :177.12 g/mol4-Chloro-2,5-dimethoxynitrobenzene
CAS :Produit contrôlé<p>4-Chloro-2,5-dimethoxynitrobenzene (CDMNB) is a solvent and a synthetic intermediate. It is soluble in diethylene, solvents, and sodium formate. CDMNB can be reduced with catalytic reduction or amines to 2,5-dimethoxybenzoic acid. CDMNB has been shown to react with xylene under catalytic conditions to produce 4-chloro-3,5-dimethoxybenzoic acid. This reaction can be monitored by liquid phase chromatography or cyclic voltammetry.</p>Formule :C8H8ClNO4Degré de pureté :Min. 95%Masse moléculaire :217.61 g/mol[1-Methyl-2-(7-methyl-1H-indol-3-yl)ethyl]amine hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about [1-Methyl-2-(7-methyl-1H-indol-3-yl)ethyl]amine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H16N2Degré de pureté :Min. 95%Masse moléculaire :188.27 g/mol2-Chloroethyl ethyl ether
CAS :<p>2-Chloroethyl ethyl ether is a fluorescence probe that can be used in the viscosity measurement of polymers. In lung fibroblast cells, 2-chloroethyl ethyl ether induces cationic polymerization. This reaction mechanism has been elucidated by computational methods. The functional groups are hydroxide and chloride. 2-Chloroethyl ethyl ether is a liquid at room temperature and morphology is hexagonal crystal. 2-Chloroethyl ethyl ether has been shown to form micelles in sodium hydroxide solution and hexane.</p>Formule :C4H9ClODegré de pureté :Min. 95%Masse moléculaire :108.57 g/molTetradecafluoro-2-methylpentane
CAS :Produit contrôlé<p>Tetradecafluoro-2-methylpentane is a fluorinated hydrocarbon that is used in synthetic chemistry. It has been shown to inhibit the growth of cancer cells and leaves. Tetradecafluoro-2-methylpentane has also been shown to be an anthropogenic emission and may contribute to global warming. The chemical is classified as a cyclic hydrocarbon, which means it contains two or more rings of carbon atoms. Cyclic hydrocarbons are generally toxic because they disrupt normal cellular function through interference with cell membranes, protein synthesis, and DNA replication.</p>Formule :C6F14Degré de pureté :Min. 95%Masse moléculaire :338.04 g/mol9-Iodo-1,2-carbarone
CAS :Produit contrôlé<p>Please enquire for more information about 9-Iodo-1,2-carbarone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :IC2B10H11Degré de pureté :Min. 95%Masse moléculaire :2,431.11 g/mol7-Bromo-1-methyl-1H-imidazo[4,5-c]pyridine
CAS :<p>Please enquire for more information about 7-Bromo-1-methyl-1H-imidazo[4,5-c]pyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C7H6BrN3Degré de pureté :Min. 95%Masse moléculaire :212.05 g/moltert-Butyl 4-(2-bromophenyl)piperazine-1-carboxylate
CAS :Produit contrôlé<p>Please enquire for more information about tert-Butyl 4-(2-bromophenyl)piperazine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%3,4-Difluorostyrene
CAS :<p>3,4-Difluorostyrene is a synthetic compound that can be used to manufacture ticagrelor. It is an organic chemical with the chemical formula C8H6F2O2. 3,4-Difluorostyrene is an organic solvent and can be used as an antithrombotic agent. 3,4-Difluorostyrene has been shown to have optimum temperature of 40°C and is mainly used in preparative reactions.</p>Formule :C8H6F2Degré de pureté :Min. 95%Couleur et forme :Colourless To Pale Yellow LiquidMasse moléculaire :140.13 g/mol9-Deschloro-9-bromo beclomethasone dipropionate
CAS :Produit contrôlé<p>Please enquire for more information about 9-Deschloro-9-bromo beclomethasone dipropionate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C28H37BrO7Degré de pureté :Min. 95%Masse moléculaire :565.49 g/mol4-Chlorobenzyl cyanide
CAS :<p>4-Chlorobenzyl cyanide is a synthetic compound that has been shown to have potent antibacterial activity. This compound reacts with hydrogen chloride in the presence of isopropyl group and chloride to form 4-chlorobenzaldehyde. The reaction selectivity of this reactive chemical is due to its fluorescence properties, which can be used as a marker for detection. The introduction of hydrogen chloride into the reaction mixture produces an acidic environment, which promotes the production of chloroform. The chloroform is then removed by evaporating the water from the reaction mixture, leaving 4-chlorobenzaldehyde as a solid product.</p>Formule :C8H6ClNDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :151.59 g/mol4-(Piperazinomethyl)benzonitrile, hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about 4-(Piperazinomethyl)benzonitrile, hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H16ClN3Degré de pureté :Min. 95%Masse moléculaire :237.73 g/mol2-Chloro-4-iodo-6-(trifluoromethyl)pyridine
CAS :<p>2-Chloro-4,6-difluoro-pyridine is an electrophilic compound that can react with nucleophiles to form covalent bonds. This reaction is known as nucleophilic substitution and it can be used in the synthesis of organic compounds. The diisopropylamide of lithium is a popular reagent for this purpose because it is inexpensive, highly reactive, and easily purified by distillation. In particular, 2-chloro-4,6-difluoro-pyridine reacts quantitatively with lithium diisopropylamide to form 4-(2-chloro-4,6-difluoro)pyrimidin-2(1H)-ones in tetrahydrofuran.</p>Formule :C6H2ClF3INDegré de pureté :Min. 95%Couleur et forme :Solid.Masse moléculaire :307.44 g/molrac-3,4-dimethyl methcathinone hydrochloride
CAS :Produit contrôlé<p>Please enquire for more information about rac-3,4-dimethyl methcathinone hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H18ClNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :227.73 g/mol2-Iodo-5-methylpyrimidine
CAS :<p>Please enquire for more information about 2-Iodo-5-methylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C5H5IN2Degré de pureté :Min. 95%Masse moléculaire :220.01 g/mol2-Iodothioanisole
CAS :<p>2-Iodothioanisole is a synthetic compound that is used as an inhibitor of the enzyme cox-2. It has been shown to inhibit the production of prostaglandins, which are involved in inflammation and pain. 2-Iodothioanisole also inhibits chloride channels, which may be related to its anti-inflammatory activity. This molecule was synthesized by coupling two chlorides with a palladium catalyst. The chlorine atoms were introduced into the molecule using a cross-coupling reaction. 2-Iodothioanisole has been shown to inhibit cox-2 by binding to the active site of this enzyme. 2-Iodothioanisole has also been found to have anti-inflammatory properties, mediated by its inhibition of prostaglandin synthesis and chloride channels.</p>Formule :C7H7ISDegré de pureté :Min. 95%Masse moléculaire :250.1 g/molBenzylbis(triphenylphosphine)palladium(II) Chloride
CAS :Produit contrôlé<p>Benzylbis(triphenylphosphine)palladium(II) Chloride is an organic compound that contains a benzene and palladium complex. The anion of this compound is chloride and it has been used as a reagent in the preparation of nitroarenes, porphyrin complexes, and various other organic compounds. This salt is insoluble in water and organic solvents, and it has been used as a sensor for chloride ions. Benzylbis(triphenylphosphine)palladium(II) Chloride’s color changes from green to red in the presence of chloride ions, which can be detected by potentiometric titration or colorimetric analysis.</p>Formule :C43H37ClP2PdDegré de pureté :Min. 95%Masse moléculaire :757.57 g/molPoly(allylamine hydrochloride) - MW 15000
CAS :<p>Allylamine HCl content - max 7%</p>Formule :(C3H7N)x•(HCl)xCouleur et forme :Clear Liquid8-Chloro-1-methyl-6-phenyl-4H-Imidazo[1,5-a][1,4]benzodiazepine
CAS :Produit contrôlé<p>Please enquire for more information about 8-Chloro-1-methyl-6-phenyl-4H-Imidazo[1,5-a][1,4]benzodiazepine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H14ClN3Degré de pureté :Min. 95%Masse moléculaire :307.78 g/molN-[(1S)-1-(Aminocarbonyl)propyl]-4-chlorobutanamide
CAS :<p>Please enquire for more information about N-[(1S)-1-(Aminocarbonyl)propyl]-4-chlorobutanamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H15ClN2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :206.67 g/mol1,3,5-Trifluorotrichlorobenzene
CAS :<p>Applications 1,3,5-Trifluorotrichlorobenzene is a useful reagent.<br></p>Formule :C6Cl3F3Masse moléculaire :235.422-Aminoethanesulphonamide monohydrochloride
CAS :<p>2-Aminoethanesulphonamide monohydrochloride is a perovskite with a hexagonal shape. It has been shown to interact with the pharmacophore of the enzyme cytochrome P450, and it has been optimized for the reaction by altering its structure. This product is soluble in gaseous form, but can also be used as a solid. 2-Aminoethanesulphonamide monohydrochloride has an absorption maximum at 325 nm and emits fluorescence at 420 nm. It is used in devices that detect ionizing radiation.</p>Formule :C2H8N2O2S•HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :160.62 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C43H47FN4O15Degré de pureté :Min. 95%Masse moléculaire :878.85 g/mol2-Bromo-1-indanol
CAS :<p>2-Bromo-1-indanol is an industrial solvent used in the production of dyes, pigments, perfumes, pharmaceuticals, and other organic compounds. It is a chiral compound with two stereoisomers (R and S) that have different properties. The R isomer has a hydroxyl group on the 2 position of the indane ring, while the S isomer does not. The industrial process involves recycling of 2-bromo-1-indanol from the reaction mixture. This process can be monitored using mass spectrometric detection for bromine and hydrogen ions released during hydrolysis.<br>2-Bromo-1-indanol can be used to synthesize methoxybenzaldehyde with high regioselectivity, which can then be used to make some drugs such as amphetamine and methamphetamine.</p>Formule :C9H9BrODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :213.07 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS :<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H41N5O6Degré de pureté :Min. 95%Masse moléculaire :459.58 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS :<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C56H78N16O13Degré de pureté :Min. 95%Masse moléculaire :1,183.32 g/molTIP-39 trifluoroacetate salt
CAS :<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C202H325N61O54SDegré de pureté :Min. 95%Masse moléculaire :4,504.19 g/mol4-Chloro-Nicotinic acid ethyl ester hydrochloride
CAS :<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>Formule :C8H8ClNO2·HClDegré de pureté :Min. 95%Masse moléculaire :222.07 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS :<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formule :C70H113N25O13SDegré de pureté :Min. 95%Masse moléculaire :1,544.87 g/mol5-Bromo-2-hydroxy-3-methyl pyrazine
CAS :<p>Please enquire for more information about 5-Bromo-2-hydroxy-3-methyl pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%1,3,6,8-Tetrabromopyrene
CAS :<p>1,3,6,8-Tetrabromopyrene is a brominated derivative of pyrene. It has been shown to be chemically stable and does not react with fatty acids in the same way as other chemicals. 1,3,6,8-Tetrabromopyrene has been used in a study on luminescent probes for electrochemical studies. The probes were synthesized by coupling 1,3,6,8-tetrabromopyrene with an electron donor (e.g., 8-hydroxyquinoline) or acceptor (e.g., triethanolamine). The probe was then applied to a metal surface where it could be observed through electrochemical impedance spectroscopy. This chemical is also used as a functional theory to study the uptake of heavy metals onto polymer matrices. One example of this is when 1,3,6,8-tetrabromopyrene is doped into poly(vinylidene</p>Formule :C16H6Br4Degré de pureté :Min. 95%Couleur et forme :Off-White PowderMasse moléculaire :517.83 g/mol2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride
CAS :<p>2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is a benzimidazole derivative. It has a chemical stability and can be used for wastewater treatment. It is also a pump inhibitor and can be used for anhydrous sodium magnesium salts. This product is synthesized from the reaction of protonated 2-bromo-4-methoxyphenol with 2,6-dimethylpyridine in the presence of hydrochloric acid. The reaction was carried out in an asymmetric synthesis using a proton transport system. 2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is soluble in water and has a pH of 1 to 3. It has been shown that this product can be used as an antioxidant and as a metal chelation agent.</p>Formule :C9H13Cl2NODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :222.11 g/mol1,4,5,8-Tetrachloroanthraquinone
CAS :<p>1,4,5,8-Tetrachloroanthraquinone is a chlorinated aromatic compound that has been shown to have anticancer activity in vitro. This compound is an effective inhibitor of the production of reactive oxygen species from nitric oxide and hydrogen peroxide. It also inhibits the growth of cancer cells by binding to their cell membranes. 1,4,5,8-Tetrachloroanthraquinone binds to the carboxylate and functional groups on the surface of cancer cells and changes the conformation of their cell membrane proteins. The structural analysis revealed that this compound contains cycloalkyl groups with chlorine substituents on each ring. Immobilized 1,4,5,8-tetrachloroanthraquinone has been shown to be an effective agent against denitrification in soil samples containing nitrate.</p>Formule :C14H4Cl4O2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :345.99 g/mol1H,1H,2H,2H-Heptadecafluorodecyl iodide
CAS :Produit contrôlé<p>1H,1H,2H,2H-Heptadecafluorodecyl iodide is a volatile chemical that is used in the transport of various analytes. It can be used to detect alcohols and organic chemicals in the environment. 1H,1H,2H,2H-Heptadecafluorodecyl iodide has been sporadically found in the atmosphere of China.</p>Formule :C10H4F17IDegré de pureté :Min. 95%Masse moléculaire :574.02 g/mol2-Methyl-5-chloromethylpyridineHydrochloride
CAS :<p>Please enquire for more information about 2-Methyl-5-chloromethylpyridineHydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C7H9Cl2NDegré de pureté :Min. 95%Masse moléculaire :178.06 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C53H70N12O20Degré de pureté :Min. 95%Masse moléculaire :1,195.19 g/mol2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride
CAS :<p>Please enquire for more information about 2-Boc-2,9-Diazaspiro[5.5]undecane hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C14H27ClN2O2Degré de pureté :Min. 95%Masse moléculaire :290.83 g/mol1,6-Diaminohexane dihydrochloride
CAS :<p>1,6-Diaminohexane dihydrochloride is a chemical that is used in the analytical method for the determination of p-hydroxybenzoic acid. It has also been used to measure fatty acids and anhydrous sodium. The sample preparation required for this chemical includes mixing with water and adding hydroxyl groups. A toxicological study on 1,6-diaminohexane dihydrochloride shows that it has no acute toxicity in rats. However, it does show some signs of toxicity in rabbits and dogs at high doses. Amine compounds are usually very reactive due to the presence of a lone electron pair on nitrogen.</p>Formule :C6H18Cl2N2Degré de pureté :Min. 95%Masse moléculaire :189.13 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C116H175N31O35S2Degré de pureté :Min. 95%Masse moléculaire :2,627.95 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS :<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formule :C42H65N13O10•C2HF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,026.07 g/molOrphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C127H195N37O37Degré de pureté :Min. 95%Masse moléculaire :2,832.13 g/molNeuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C113H192N36O39Degré de pureté :Min. 95%Masse moléculaire :2,678.95 g/mol4-Amino-6-chloro-1,3-benzenedisulfonamide
CAS :<p>4-Amino-6-chloro-1,3-benzenedisulfonamide is a natural substance that has been used in Chinese medicine preparations for the treatment of cardiac problems. It belongs to the class of organic compounds called benzenedisulfonamides. 4-Amino-6-chloro-1,3-benzenedisulfonamide is produced by the bacterial enzyme aminase from amino acid and benzoic acid. The adsorption mechanism of 4-Amino-6-chloro-1,3-benzenedisulfonamide is not fully understood, but it is believed that the benzyl groups are key players in this process. The high affinity of 4-Amino-6-chloro1,3 benzenedisulfonamide to proteins may be due to its ability to form hydrogen bonds with protein side chains, such as serine or threonine residues. 4 Amino</p>Formule :C6H8ClN3O4S2Degré de pureté :Min. 95%Couleur et forme :White To Light Brown SolidMasse moléculaire :285.73 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS :<p>Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C82H149N31O26SDegré de pureté :Min. 95%Masse moléculaire :2,017.32 g/molH-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond)
CAS :<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C57H71N11O12S2Degré de pureté :Min. 95%Masse moléculaire :1,166.37 g/mol(β-Asp5)-δ-Sleep Inducing Peptide trifluoroacetate salt
CAS :<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>Formule :C35H48N10O15Degré de pureté :Min. 95%Masse moléculaire :848.81 g/molPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
CAS :<p>Pancreastatin is a cytosolic protein that inhibits the production of peptide hormones such as glucagon, insulin, and gastrin. It is used to treat bowel disease, including carcinoid syndrome and inflammatory bowel disease. Pancreastatin has been shown to inhibit the activity of cyclase enzymes that are responsible for the production of these hormones. Pancreatic beta-cells produce pancreatic polypeptide (PP), which is converted by pancreastatin into inactive PP2. Pancreatic alpha-cells produce somatostatin (SS), which is converted by pancreastatin into inactive SS2. Pancreatic delta cells produce pancreatic polypeptide (PP), which is not affected by pancreastatin. Pancreatic somatostatinomas secrete SS, which is not affected by pancreastatin.</p>Formule :C214H330N68O76SDegré de pureté :Min. 95%Masse moléculaire :5,103.39 g/molVasonatrin Peptide (VNP) trifluoroacetate salt
CAS :<p>Please enquire for more information about Vasonatrin Peptide (VNP) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C123H198N36O36S3Degré de pureté :Min. 95%Masse moléculaire :2,853.31 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C175H290N56O59Degré de pureté :Min. 95%Masse moléculaire :4,122.52 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS :<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Formule :C50H73N13O11Degré de pureté :Min. 95%Masse moléculaire :1,032.2 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS :<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C54H66Cl2N12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,146.22 g/molNeuropeptide Y (13-36) (porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide Y (13-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C135H209N41O36Degré de pureté :Min. 95%Masse moléculaire :2,982.36 g/mol5-bromo-2-(trifluoromethyl)benzoic Acid
CAS :<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H4BrF3O2Degré de pureté :Min. 95%Masse moléculaire :269.02 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C60H100N22O14S3Degré de pureté :Min. 95%Masse moléculaire :1,449.77 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formule :C61H110N24O14Degré de pureté :Min. 95%Masse moléculaire :1,403.68 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C68H107N19O17SDegré de pureté :Min. 95%Masse moléculaire :1,494.76 g/molMonocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C59H98N18O22Degré de pureté :Min. 95%Masse moléculaire :1,411.52 g/molDi-tert-butylchlorophosphine
CAS :<p>Di-tert-butylchlorophosphine is a nucleophilic reagent used for the cross-coupling of aryl chlorides. It reacts with an amine to produce an imine, which can be hydrolyzed to form an amide. Di-tert-butylchlorophosphine is typically used in palladium-catalyzed coupling reactions and can react with ethene, propene, and butadiene to produce ethylbenzene, propenal, and butadienal. This compound also has been used as a precursor in the preparation of antiviral drug Covid®19. The reaction temperature for this compound is typically between -40°C and 0°C.</p>Formule :C8H18ClPDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :180.65 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS :<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>Formule :C54H78N16O10Degré de pureté :Min. 95%Masse moléculaire :1,111.3 g/molZinc trifluoromethanesulfonate
CAS :<p>Zinc trifluoromethanesulfonate is a catalyst that catalyses the reaction of amines with coumarin derivatives, producing an electrochemical impedance spectroscopy. It has been shown to have a redox potential that is higher than ferrocenecarboxylic acid. Zinc trifluoromethanesulfonate has been used in asymmetric synthesis, which involves substituting a hydrogen atom with another atom or group, and in salt metathesis, which is the process of forming new chemical compounds from reactants without using any energy. The zinc trifluoromethanesulfonate can also be activated by light or heat. This makes it possible for this compound to release the corrosive sulfur dioxide gas when heated to high temperatures, producing a synergic effect with other substances such as potassium permanganate (KMnO4).</p>Formule :C2F6O6S2ZnDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :363.52 g/mol1-Bromo-3,3-dimethylbutane
CAS :<p>1-Bromo-3,3-dimethylbutane is an alkali metal compound that can be used as a substitute for ethylene. It is expressed in the liquid phase and reacts with halogens to form reactive intermediates. These reactive intermediates react with other molecules to cause bond cleavage. The reaction time is dependent on the temperature of the system. 1-Bromo-3,3-dimethylbutane has three isomers that are formed during the reaction: 2-, 3-, and 4-bromohexane. The mechanism for this reaction involves a single electron transfer from one molecule to another, which causes a series of reactions that leads to the formation of 1-bromo-3,3-dimethylbutane. This process occurs spontaneously due to irradiation by ultraviolet light or electron beams.</p>Formule :C6H13BrDegré de pureté :Min. 95%Masse moléculaire :165.07 g/molH-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt
CAS :<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>Formule :C26H42N8O8Degré de pureté :Min. 95%Masse moléculaire :594.66 g/mol(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS :<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formule :C9H11ClODegré de pureté :Min. 95%Masse moléculaire :170.64 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C181H278N54O55Degré de pureté :Min. 95%Masse moléculaire :4,090.47 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C202H325N53O64SDegré de pureté :Min. 95%Masse moléculaire :4,552.13 g/molH-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution)
<p>Please enquire for more information about H-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Methyl 2-amino-6-bromobenzoate
CAS :<p>Please enquire for more information about Methyl 2-amino-6-bromobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H8BrNO2Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :230.06 g/molTribromomethyl phenyl sulfone
CAS :<p>Tribromomethyl phenyl sulfone is an alkylthio compound that has a cyclohexane ring and a hydroxy group. Tribromomethyl phenyl sulfone has high resistance to thermal expansion, hydrolysis, and radiation. It reacts with silver ions to form bromophenyl silver ion. This molecule can be formed through the reaction of diphenyl ether with hydrogen sulfide in the presence of light, or by the reaction of benzene with sodium hydroxide in the presence of light. Tribromomethyl phenyl sulfone is used as a stabilizer for plastics and other organic materials, as well as an antioxidant for rubber products.</p>Formule :C7H5Br3O2SDegré de pureté :Min. 95%Masse moléculaire :392.89 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Masse moléculaire :555.63(Dab 9)-Neurotensin (8-13) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C36H60N10O8Degré de pureté :Min. 95%Masse moléculaire :760.92 g/molH-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Atrial Natriuretic Factor (1-28) (human) hydrochloride salt
CAS :Produit contrôlé<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C127H203N45O39S3Degré de pureté :Min. 95%Masse moléculaire :3,080.45 g/mol(1,2-Dibromoethyl)benzene
CAS :<p>(1,2-Dibromoethyl)benzene is an organic compound that belongs to the group of cationic surfactants. It can be used as a particle in analytical methods and has been shown to react with hydroxyl groups on the surface of silica gel. (1,2-Dibromoethyl)benzene has also been used in a reaction with chlorides, nitrates, and inorganic acids to form hydrochloric acid. The reaction products are hydroxyl group, chloride, nitrogen atoms, inorganic acid, hydroxy group, hydrogen chloride, diameter, water vapor.</p>Formule :C8H8Br2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :263.96 g/mol2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene
CAS :<p>2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene is a chemical compound that is used as a sensor for electron transfer in organic molecules. When the molecule is oxidized, the bromine atom is reduced to hydrogen bromide, which is able to conduct electricity. This allows it to be used as a sensing electrode to measure electron transfer in organic molecules. 2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene has been synthesized using experimental techniques and geometry experiments. The transport of electrons can be measured using electrodes with tripodal geometry with nanoscale dimensions.</p>Formule :C15H12BrIDegré de pureté :95%NmrMasse moléculaire :399.06 g/molDefensin HNP-1 (human) trifluoroacetate salt
CAS :<p>Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.</p>Formule :C150H222N44O38S6Degré de pureté :Min. 95%Masse moléculaire :3,442.04 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS :<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>Formule :C190H287N55O57Degré de pureté :Min. 95%Masse moléculaire :4,253.65 g/molAstressin trifluoroacetate salt
CAS :<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Formule :C161H269N49O42Degré de pureté :Min. 95%Masse moléculaire :3,563.16 g/mol2-Bromopyrazine
CAS :<p>2-Bromopyrazine is a heterocyclic chemical compound that inhibits the activity of enzymes such as kinases. It has been shown to have anti-tumor properties in clinical studies and has been used in cancer research. 2-Bromopyrazine binds to nicotinic acetylcholine receptors, which are found on the surface of tumor cells. The binding of 2-bromopyrazine to these receptors causes an increase in ion flow across the membrane and leads to cell death. This drug also inhibits kinase activity, leading to decreased protein synthesis, which may account for its anti-tumor properties. 2-Bromopyrazine is soluble in organic solvents and insoluble in water. 2-Bromopyrazine is stable under acidic conditions but undergoes hydrolysis by hydrochloric acid, forming a salt and hydrogen bromide gas.</p>Formule :C4H3BrN2Degré de pureté :Min. 95%Couleur et forme :Colorless Clear LiquidMasse moléculaire :158.98 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS :<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C50H63N15O13Degré de pureté :Min. 95%Masse moléculaire :1,082.13 g/mol4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid
CAS :<p>4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.</p>Formule :C9H5F3N2O2Degré de pureté :Min. 95%Couleur et forme :White/Off-White SolidMasse moléculaire :230.14 g/mol3-(3'-Trifluoromethylphenyl)propanol
CAS :<p>3-(3'-Trifluoromethylphenyl)propanol is a trifluoroacetic acid derivative that is used in acylation reactions to form esters. It can be obtained by the reaction of aluminium chloride, isopropyl alcohol, and phosphine with 3-trifluoromethylaniline. Impurities may include chloride and zirconium. The trifluoromethyl group on this molecule can react with the carbonyl group of an organic acid to form a trifluoroacetate ester.</p>Degré de pureté :Min. 95%(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS :<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formule :C47H67N11O11S2Degré de pureté :Min. 95%Masse moléculaire :1,026.23 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C69H85FN16O13Degré de pureté :Min. 95%Masse moléculaire :1,365.51 g/molH-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Defensin HNP-2 (human) trifluoroacetate salt
CAS :<p>Defensin HNP-2 is a peptide that has been shown to bind to cancer cells, metabolic disorders, and endometriosis. It also has pharmaceutical preparations for treating microbial infection and other diseases. Defensin HNP-2 is a broad-spectrum antimicrobial peptide and it binds to bacterial membranes in the cell cytoplasm. Defensin HNP-2 may be used as diagnostic agents or in the treatment of microbial infections. This antimicrobial peptide is stable when complexed with calcium ions and can be used against s. aureus strains that are resistant to antibiotics such as ciprofloxacin.</p>Formule :C147H217N43O37S6Degré de pureté :Min. 95%Masse moléculaire :3,370.96 g/molH-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Uroguanylin Topoisomer A (human) trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C64H102N18O26S4Degré de pureté :Min. 95%Masse moléculaire :1,667.86 g/mol9,9-Dioctyl-7-dibromofluorene
CAS :<p>9,9-Dioctyl-7-dibromofluorene is a linear polymer with an ethylene diamine backbone. It is a synthetic material that can be used for devices such as solar cells. 9,9-Dioctyl-7-dibromofluorene has been shown to have efficient light emission properties and high optical absorption in the visible region of the electromagnetic spectrum. The device efficiency of this material has been shown to be improved by substituent effects and reaction time.</p>Formule :C29H40Br2Degré de pureté :Min. 95%Masse moléculaire :548.44 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS :<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C126H195N37O37Degré de pureté :Min. 95%Masse moléculaire :2,820.12 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C141H203N41O38Degré de pureté :Min. 95%Masse moléculaire :3,080.37 g/molH-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%3-(Trifluoromethyl)phenylacetic acid
CAS :<p>3-(Trifluoromethyl)phenylacetic acid is an isoquinoline alkaloid that has been found to have anti-inflammatory properties. It was shown to inhibit TNF-α production in mice with colitis, reducing the severity of the disease. 3-(Trifluoromethyl)phenylacetic acid can be administered orally, and it is metabolized reductively by dihydroisoquinoline reductase enzymes. The drug's pharmacokinetics are not well understood, but it is thought to be a substrate for CYP3A4 and P-glycoprotein. 3-(Trifluoromethyl)phenylacetic acid has been studied as a potential antiviral agent and systemic inflammatory response inhibitor.</p>Formule :C9H7F3O2Degré de pureté :Min. 95%Masse moléculaire :204.15 g/mol3-Fluoro-2-nitrobenzaldehyde
CAS :<p>3-Fluoro-2-nitrobenzaldehyde is a pyridine derivative that has been used in the synthesis of a number of important heterocyclic compounds. This compound can be prepared by reacting 3,4-dichloroaniline with nitrous acid and then hydrolyzing the resulting 3-chloroquinoline with hydrochloric acid. The reaction yields anilines and quinolines in regiospecifically, as well as formylation, cyclisation, and condensation products. It is also capable of aromatisation reactions with benzene to produce benzofuran derivatives.</p>Formule :C7H4FNO3Degré de pureté :Min. 95%Couleur et forme :Yellow PowderMasse moléculaire :169.11 g/mol2-Bromo-6-methylpyridine-3-carboxaldehyde
CAS :<p>2-Bromo-6-methylpyridine-3-carboxaldehyde (BMPCA) is a pharmacological agent that belongs to the group of antagonists. It has been shown to be a potent antagonist at the NMDA receptor and may be used for treating neuropathic pain. BMPCA also has been shown to have competitive inhibition at the naphthyridine receptor, which may allow it to act as an antagonist or an agonist depending on its binding site. The regioisomeric analogs of BMPCA are 2-(2,5-dichloropyridyl)-6-methylpyridine-3-carboxaldehyde and 2-(2,5-dimethylpyridyl)-6-methylpyridine-3-carboxaldehyde. These analogs have been shown to inhibit the growth of tumor cells in vitro and in vivo.</p>Formule :C7H6BrNODegré de pureté :Min. 95%Masse moléculaire :200.03 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C68H105N17O12SDegré de pureté :Min. 95%Masse moléculaire :1,384.73 g/molOM99-2trifluoroacetate salt
CAS :<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C41H64N8O14Degré de pureté :Min. 95%Masse moléculaire :892.99 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS :<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formule :C41H57N13O8Degré de pureté :Min. 95%Masse moléculaire :859.97 g/molZ-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt
CAS :<p>Please enquire for more information about Z-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H25N5O6Degré de pureté :Min. 95%Masse moléculaire :443.45 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C59H84N18O13·xC2HF3O2Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :1,253.41 g/molGlycinamide hydrochloride
CAS :<p>Glycinamide hydrochloride is an inhibitor that binds to the glycine-binding site of the protein synthetase and inhibits the formation of glycinamide ribonucleotide. It has been shown to inhibit human glycinamide ribonucleotide synthetase in vitro. Glycinamide hydrochloride is also a glycinamide amide, which was synthesized by linking two molecules of glycine with an amide bond. This molecule is cross-linked with a macrogel, forming a hydrogel. The hydrogel can be used in biomedical applications, such as tissue engineering and drug delivery systems.</p>Formule :C2H7ClN2OCouleur et forme :White PowderMasse moléculaire :110.54 g/molBIM-23627 trifluoroacetate salt
CAS :<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C58H69ClN12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,161.83 g/mol

