Produits biochimiques et réactifs

Boceprevir metabolite M15 is a potent and selective inhibitor of the hepatitis C virus NS3 protease. It binds to the active site of the enzyme and inhibits its activity, which prevents viral replication. Boceprevir metabolite M15 has shown no significant affinity for other proteins and has been shown to be highly pure.

TC SL C5 is a monoclonal antibody that binds to the extracellular domain of human growth hormone receptor and inhibits its activity. The antibody is useful as a research tool in cell biology, pharmacology, and ligand-receptor interactions. TC SL C5 has been shown to inhibit the activation of human platelets by thrombin, which is mediated by the binding of thrombin to its receptor on platelets. TC SL C5 also inhibits the ionic current in rat brain cells, which may be due to its ability to bind to potassium channels.

Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

CCT036477 is a novel, potent inhibitor of the Wnt signaling pathway. It has been shown to inhibit tumor cell proliferation and induce apoptosis in cancer cells. CCT036477 inhibits protein transport by binding to the surface glycoprotein and blocking the receptor activity. This drug has also been shown to be effective against chemotherapeutic treatment in animal models, such as platinum-based chemotherapy, and to reduce the size of prostate cancer cells in vitro. Clinical trials are currently underway for CCT036477 to treat skin cancer and human osteosarcoma cell.

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB6 antibody, catalog no. 70R-3524

KAG-308 is a research tool that is used as an activator or ligand for receptor binding. It has been shown to have a high affinity for the nicotinic acetylcholine receptor, which is important in the transmission of signals from the nervous system to muscles and glands. KAG-308 also interacts with ion channels and is a potential inhibitor of protein synthesis.

BVT 2733 is a drug that has been shown to have a metabolic effect on osteogenic genes. It is an inhibitor of the enzyme fatty acid synthase and has been shown to reduce the production of pro-inflammatory cytokines in adipose tissue, which may contribute to its anti-inflammatory properties. BVT 2733 also inhibits the synthesis of chemoattractant protein and polymerase chain reaction, which are involved in inflammatory bowel disease. This drug has been tested for pharmacokinetic properties, which have been found to be increased in cardiac and skin cells. The pharmacological activity of BVT 2733 is not fully understood yet; however, it has been shown to have glucocorticoid receptor agonist activity in vitro.

BCI-121 is an investigational drug that inhibits the enzyme lysine methyltransferase (KMT), which is involved in the methylation of histones and other cellular proteins. BCI-121 has been shown to inhibit tumor growth and induce tumor cell death by inhibiting mitochondrial functions. The mechanism of action for BCI-121 involves epigenetic regulation of gene expression, meaning that it controls the activity of genes without altering their DNA sequence. In cancer cells, BCI-121 inhibits the synthesis of DNA, RNA, and protein, leading to apoptosis. This drug also shows potential for treating inflammatory diseases such as rheumatoid arthritis by inhibiting KMT activity in immune cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of HMG1L10 antibody, catalog no. 20R-1115

The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF420 antibody, catalog no. 70R-4414

2-(((2-(Dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl)isonicotinic acid is a research tool that belongs to the class of ligands. It is an activator of nicotinic acetylcholine receptors (nAChRs). This compound has been shown to inhibit voltage-gated potassium channels and calcium channels. 2-(((2-(Dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl)isonicotinic acid has also been shown to bind the alpha7 nicotinic acetylcholine receptor (α7nAChR), which is found in high levels in the hippocampus and cortex. The binding of this compound to α7nAChR causes an increase in the release of glutamate, a neurotransmitter that plays a role in memory and learning.

IL 10 rat (IL-10) is a cytokine that belongs to the family of IL-10 cytokines. IL-10 binds to the IL-10 receptor and inhibits the release of proinflammatory cytokines, including TNF-α, IL-1β, and IL-6. This cytokine has been shown to inhibit the production of reactive oxygen species by macrophages and neutrophils. The physiological role of this cytokine is not yet fully understood, but it is believed to be important for immune regulation in response to bacterial infections.

G6PDI-1 is a potent, selective, and reversible inhibitor of the enzyme glucose-6-phosphate dehydrogenase. The enzyme is used in glycolysis to produce NADPH. G6PDI-1 has been used as a research tool with applications in cell biology, pharmacology, and protein interactions. This ligand has also been shown to bind to a receptor that regulates ion channel activity.

Oxybutynin-d11 chloride is a potent inhibitor of voltage-gated potassium channels. It binds to the channel, blocking the flow of potassium ions through the membrane. This prevents the cell from firing action potentials, preventing it from sending messages to other cells and regulating its own excitability. Oxybutynin-d11 chloride is a useful research tool for studying ion channels in various systems such as pharmacology, protein interactions, and cell biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDKN2AIP antibody, catalog no. 70R-4954

LDN-212854 is a human immunoglobulin that blocks the Toll-like receptor 4 (TLR4) and inhibits TLR4 signaling pathways. It has been shown to have an effect on several types of cancer, including prostate, breast, and lung cancer. LDN-212854 also has pharmacokinetic properties that allow it to be used in both intravenous and subcutaneous injections. LDN-212854 binds to TLR4 receptors in the cells of the immune system by interfering with the binding of LPS, which is a molecule found on the surface of gram negative bacteria. This prevents activation of TLR4 signaling pathways downstream from LPS binding. LDN-212854 also blocks IL-1β production by inhibiting NFκB activation in response to LPS stimulation.

A synthetic peptide for use as a blocking control in assays to test for specificity of OLFML2A antibody, catalog no. 70R-4200

2-(3,4-Dihydroxybenzoyl)-3-(4-hydroxy-3-iodo-5-methoxyphenyl)prop-2-enenitrile is a high purity ion channel inhibitor with IC50 of 1.8 nM. It has been shown to inhibit the activity of voltage gated sodium channels in rat hippocampal neurons and human erythrocytes. The binding affinity of 2-(3,4-dihydroxybenzoyl)-3-(4-hydroxy-3-iodo-5 methoxyphenyl)prop-2 enenitrile for the nicotinic acetylcholine receptor (nAChR), as determined by competitive radioligand binding assay, is 21 pM. This compound also inhibits the activity of potassium channels and has been shown to bind to peptides and antibodies.

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R3A antibody, catalog no. 70R-6844

GKT136901 is a potent, selective, and orally bioavailable small molecule that activates the G protein-coupled receptor GPR35. It has been shown to have minimal effect on other receptors. This agent has been shown to be an effective inhibitor of the bacterial enzyme phosphodiesterase 4 (PDE4) with IC50 values of 0.1 nM and 0.5 nM in human cells, respectively. It also inhibits the activity of the human PDE4D3 isoform with an IC50 value of 10 nM in vitro.

QL47 is a molecule that inhibits phosphorylation of protein and translation. It also has anti-inflammatory properties and can be used to treat autoimmune diseases and inflammatory diseases. QL47 binds to the ferroelectric domain in the cell membrane, which is involved in cellular signaling. This binding prevents the formation of a phosphate-protein complex, which inhibits phosphorylation. The inhibition mechanism is due to the hydroxyl group on QL47, which interacts with the hydroxyl group on tyrosine residues in proteins and blocks their access to phosphate groups. QL47 can be detected using mass spectrometry methods and has been shown to have pharmacokinetic properties that are dependent on dose, blood flow rate, and tissue perfusion.

A synthetic peptide for use as a blocking control in assays to test for specificity of Med19 antibody, catalog no. 70R-9337

The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.

Rabbit polyclonal SMARCD2 antibody

ELISA kit for detection of BDNF in the research laboratory

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf54 antibody, catalog no. 70R-3576

A synthetic peptide for use as a blocking control in assays to test for specificity of CCR5 antibody, catalog no. 70R-7848

AZ 13732641 is a carcinogenic agent that causes DNA damage, leading to the onset of cancer. It is a potent inhibitor of mismatch repair and has been shown to cause lung cancer in rats by inhibiting single-stranded DNA repair. AZ 13732641 also has oncogenic properties and is capable of modifying the spectrum of carcinogens, including hexavalent chromium. This drug has been shown to cause an increase in euchromatin markers, which are associated with tumor suppressors. AZ 13732641 has also been shown to inhibit human cells from dividing, which may be due to its ability to modify histones or activate apoptosis pathways.

AS 2521780 is a potent and selective inhibitor of the enzyme tyrosine phosphatase-1B (PTP-1B) that is used to treat autoimmune diseases. PTP-1B inhibitors are used as immunosuppressants in patients undergoing renal transplantation or other types of organ transplants, or for the treatment of cardiac diseases. AS 2521780 has been shown to inhibit the proliferation of T cells and CD4+CD25+Foxp3+ regulatory T cells. This drug also inhibits the proliferation of mononuclear cells, which are found in blood, and reduces the production of cytokines by these cells. The inhibition of PTP-1B may be involved in many aspects of cell function, including insulin secretion from pancreatic beta cells, glucose metabolism in muscle cells, and cardiac contractility. AS 2521780 is a potential drug target for diabetes mellitus type 2 and heart failure.

A synthetic peptide for use as a blocking control in assays to test for specificity of NEK11 antibody, catalog no. 70R-2292

Ravoxertinib hydrochloride is an investigational pharmaceutical compound, specifically a selective small molecule inhibitor. It is synthesized chemically, designed to target and inhibit specific protein kinases, particularly those associated with the ERK signaling pathway. The mode of action involves binding to these kinases, thus preventing their phosphorylation and subsequent activation. This interruption of the cellular signaling cascade can result in the suppression of tumor cell proliferation and survival.

A synthetic peptide for use as a blocking control in assays to test for specificity of PDCD7 antibody, catalog no. 70R-6011

A synthetic peptide for use as a blocking control in assays to test for specificity of Il5 antibody, catalog no. 70R-9263

GSTP1 antibody was raised using the N terminal of GSTP1 corresponding to a region with amino acids TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ

A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL1 antibody, catalog no. 70R-7382

Portion of Influenza NP

Please enquire for more information about Thalidomide-Cyanine 5 including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF382 antibody, catalog no. 20R-1228

A synthetic peptide for use as a blocking control in assays to test for specificity of ALAS2 antibody, catalog no. 70R-2482

The PFKFB3 antibody is a highly specialized tool used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is designed to target and bind to specific proteins associated with PFKFB3. This antibody can be used in various applications such as solid phase assays, histidine quantitation, and messenger RNA analysis.

ELISA kit for the detection of Cathepsin G in the research laboratory

Largazole is a ligand that binds to the ion channel TRPV4. It is an inhibitor of TRPV4 and prevents the activation of this receptor by its natural ligand, capsaicin. This inhibition has been shown to be competitive with capsaicin. Largazole also inhibits the activity of TRPV1, but does not inhibit TRPM8 or TRPA1 receptors. Largazole is also a potent activator of TRPA1 channels, which are activated by low pH, and can therefore be used as a research tool to study the effect of pH on pain sensation in animal models.
TRPV4 is widely expressed in many cell types such as neurons, astrocytes, vascular smooth muscle cells and immune cells. The binding of largazole to this receptor has been shown to activate various intracellular signaling pathways including PKCδ-dependent pathway and MAPK pathway.

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX6 antibody, catalog no. 70R-8177

A synthetic peptide for use as a blocking control in assays to test for specificity of NR1I3 antibody, catalog no. 70R-2541

A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM1 antibody, catalog no. 70R-8515

Rabbit polyclonal GAP43 antibody (Ser41)

The IGF-1R antibody is a powerful tool in the field of Life Sciences. It specifically targets the insulin-like growth factor-1 receptor, an important protein involved in cell growth and development. This antibody can be used in various research applications, including immunofluorescence, Western blotting, and immunohistochemistry.

A synthetic peptide for use as a blocking control in assays to test for specificity of PI3 antibody, catalog no. 70R-7380

7-[1-(2-Fluoropyridin-3-yl)-5-methyltriazol-4-yl]quinoline is a research tool used to study the interactions between ligands and their receptors. It can be used to identify the binding site on a receptor by its ability to activate or inhibit an ion channel, which is important for pharmacology. 7-[1-(2-Fluoropyridin-3-yl)-5-methyltriazol-4-yl]quinoline has also been shown to bind to antibodies and proteins, as well as interacting with cell membranes.

BMS-1166 is a small molecule immunotherapy agent that functions as a PD-1 antagonist. It is derived from targeted drug design, focusing on disrupting the interaction between the programmed cell death protein 1 (PD-1) and its ligands, PD-L1 and PD-L2.

Avoralstat is a small molecule that inhibits the serine protease of angiogenic and neovascular cells. It is an extracellular, inhibitory mechanism, reactive, neovascular inhibitor that binds to the catalytic site of neovascular cells. Avoralstat has been shown to be effective in eye disorders such as age-related macular degeneration and diabetic retinopathy. The molecular modeling studies have shown avoralstat's binding mode with serine protease. Avoralstat also has diagnostic properties that can be used in various diagnostic agents for different conditions such as cancer and inflammation.

IL-9 is a cytokine that is involved in the regulation of immune system. IL-9 signaling is essential for the induction of B cell responses and mast cell activation, and IL-9 is also expressed in epithelial cells. The IL-9 Mouse (CAS No. 207870-05-2) antibody reacts with IL-9 protein, which has a molecular weight of 18 kDa. This antibody detects an epitope corresponding to amino acids 1 to 13 of human Interleukin 9 (IL-9).

C20ORF3 antibody was raised using the N terminal Of C20Orf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP2 antibody, catalog no. 70R-10393

A synthetic peptide for use as a blocking control in assays to test for specificity of VPS37A antibody, catalog no. 70R-2831

A synthetic peptide for use as a blocking control in assays to test for specificity of LDHAL6B antibody, catalog no. 70R-3958

OAT antibody was raised in mouse using recombinant human OAT (33-439aa) purified from E.coli as the immunogen.

The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.

Affinity purified Rabbit polyclonal RAB6A antibody

Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.

GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

Leptin antibody was raised in rabbit using highly pure recombinant murine leptin as the immunogen.

Affinity purified Rabbit polyclonal BCL2L15 antibody

Ubiquitin is a small protein that is covalently attached to other proteins. It plays an important role in the regulation of cellular processes such as cell growth, DNA repair, and apoptosis. The most common form of ubiquitin is ubiquitin from bovine erythrocytes. Ubiquitin has been shown to have hydration properties, which have been used in assays for the determination of molecular weight. It also has been used to determine the phosphatase activity of collagenase by titration calorimetry. Proteolytic cleavage can be achieved with the use of collagenases, which are enzymes that hydrolyze peptide bonds and break down proteins into smaller polypeptides. The ubiquitin-proteasome pathway is responsible for this process and can be inhibited by the administration of proteasome inhibitors such as MG132 or lactacystin. Ubiquitination may also play a role in inflammatory diseases such

BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS

ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen

Mouse monoclonal ARHGAP25 antibody

FGF21 antibody is a monoclonal antibody that belongs to the class of antibodies used in Life Sciences. It specifically targets and inhibits the activity of vascular endothelial growth factor (VEGF), a growth factor involved in angiogenesis. This antibody has been shown to be effective in blocking the activation of VEGF, thereby preventing the formation of new blood vessels. FGF21 antibody also exhibits anticoagulant properties by inhibiting platelet aggregation, making it useful for conditions such as heparin-induced thrombocytopenia. Additionally, this antibody has natriuretic effects and can regulate fluid balance in the body. With its antiangiogenic properties, FGF21 antibody holds great potential for therapeutic applications in various diseases related to abnormal blood vessel growth.

A synthetic peptide for use as a blocking control in assays to test for specificity of VMD2L2 antibody, catalog no. 70R-1494

A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP2 antibody, catalog no. 70R-9375

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP8B2 antibody, catalog no. 70R-4519

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

SRPRB antibody was raised using the middle region of SRPRB corresponding to a region with amino acids QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE

Mouse monoclonal NGAL antibody (Biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLAIN1 antibody, catalog no. 70R-3394

A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-9407

Purified Polyclonal SERINC2 antibody

The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.

MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.

Rabbit polyclonal ZNF592 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM76A antibody, catalog no. 70R-3780

FSH ELISA kit for the quantitative measurement of FSH in human serum

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF2A antibody, catalog no. 70R-5533

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB5 antibody, catalog no. 70R-1273