Produits biochimiques et réactifs

<p>Darglitazone is a type of antidiabetic agent that belongs to the thiazolidinedione class. It is used in the treatment of type II diabetes, which is characterized by high blood glucose levels as a result of insulin resistance. Darglitazone has been shown to bind to human fatty acid receptors and activate these receptors, thereby increasing glucose uptake into cells and reducing hepatic glucose production. This drug also has metabolic effects in non-human animals, including an increase in nitrogen-containing compounds such as urea and creatinine. Darglitazone also activates transcription-polymerase chain reaction (PCR) activity on du145 cells in culture. Although the mechanism is not yet fully understood, it may be due to its ability to inhibit protein synthesis or to activate gene expression of proteins involved in the insulin signalling pathway.</p>

<p>Rabbit polyclonal IL4 antibody (FITC)</p>

<p>Rabbit polyclonal DHODH antibody</p>

EBI-2511 is a novel fungicide, which is derived from synthetic chemical processes, specifically designed to inhibit fungal growth. The source of EBI-2511 is synthetic organic chemistry, where precise molecular engineering is employed to target specific pathways in fungal metabolism.

TLR7 antibody was raised in mouse using recombinant human TLR7 (451-500aa) purified from E. coli as the immunogen.

Sesamoside is a genus of plants that belongs to the family Apocynaceae. It has been shown to have pharmacokinetic properties in a study using preparative HPLC and linear calibration curve. The physiological activities of sesamosides include inhibiting mitochondrial membrane potential, inhibiting platelet aggregation, and reducing lamiophlomis. Chemical diversity of sesamosides has been observed by analytical methods such as GC-MS and nuclear magnetic resonance (NMR). Sesamoside also has iridoid compounds that are structurally similar to those found in tuberosa. The liver cells of mice were found to be sensitive to the dose-dependent effects of sesamosides.

<p>DRG1 antibody was raised using the N terminal of DRG1 corresponding to a region with amino acids LAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNL</p>

Please enquire for more information about H-Ala-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>H3B-6545 is an investigational drug that is a CDK4/6 inhibitor. H3B-6545 has been shown to inhibit the growth of breast cancer cells in preclinical studies. The mechanism by which H3B-6545 inhibits breast cancer cell growth is not fully understood, but it appears to be related to its ability to inhibit aromatase activity and affect the expression of epidermal growth factor receptor (EGFR). The efficacy of H3B-6545 in patients with estrogen receptor (ER)-positive, HER2-negative metastatic breast cancer who have progressed following endocrine therapy or chemotherapy is currently being evaluated in a multicenter phase II study. H3B-6545 has also been shown to cause DNA mutations in vitro.</p>

<p>CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS</p>

Varicella-Zoster Virus (VZV) is a highly contagious herpesvirus (a member of the Herpesviridae family) that causes two distinct diseases:

<p>The EMR1 antibody is a powerful tool used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is commonly used for research purposes. This antibody specifically targets EMR1, a protein known as EGF-like module-containing mucin-like hormone receptor-like 1.</p>

METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

<p>TC-G 1005 is a drug that inhibits the uptake of acetylcholine in the lung. TC-G 1005 is a potent and selective inhibitor of taurocholate co-transporting polypeptide (TCCP), which is responsible for transporting bile acids into the liver. TC-G 1005 has been shown to reduce weight gain and fat deposits in mice, as well as to increase insulin sensitivity in adipose tissue. TC-G 1005 has also been shown to have positive effects on muscle function, reversing constrictions that are caused by cholinergic agents. TC-G 1005 also has anti-inflammatory properties, which may be due to its ability to inhibit the uptake of acetylcholine in bronchial passages.</p>

<p>The AIM2 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to AIM2, a protein that plays a crucial role in the activation of inflammasomes. By binding to AIM2, this antibody inhibits its function, preventing the activation of downstream signaling pathways that lead to inflammation and cell death.</p>

Rabbit polyclonal CPA5 antibody

<p>Angiotensin III, human is a peptide hormone that acts as an important regulator of blood pressure and fluid balance. It binds to angiotensin receptors on vascular smooth muscle cells, which leads to vasoconstriction and an increase in the permeability of small blood vessels. Angiotensin III also stimulates the release of aldosterone from the adrenal gland, which leads to increased sodium retention and increased water reabsorption by the kidneys. Angiotensin III is used as a treatment for congestive heart failure and pulmonary edema. It has been shown to be effective in preventing myocardial infarction in animal models. The effects of Angiotensin III are mediated by its binding to specific receptors on the surface of cells, leading to changes in cell activity. These effects can be blocked with receptor antagonists such as losartan or valsartan.</p>

G-CSF is a glycoprotein that belongs to the cytokine family and is used as a medication. It stimulates the production of neutrophils, which are important in defending the body against infections. G-CSF also has a role in stimulating stem cell production and can be used to treat cancer patients undergoing chemotherapy. G-CSF binds to receptors on the surface of cells, activating intracellular signaling pathways. The binding of G-CSF to its receptor activates phospholipase C (PLC), which hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) into two second messengers: inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG). IP3 causes release of calcium from intracellular stores, leading to an increase in cytosolic free calcium concentration. DAG activates protein kinase C (PKC)

<p>Mouse monoclonal TTC32 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K15 antibody, catalog no. 70R-2087</p>

<p>The GFAP antibody is a highly specialized tool used in Life Sciences research for insulin detection. It is a monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP), which is expressed in astrocytes, a type of brain cell. This antibody has been extensively validated and is widely used in various applications such as immunohistochemistry and Western blotting.</p>

<p>Androgen receptor antagonist; has therapeutic application in prostate cancer</p>

5-HT1B/1D serotonin receptor agonist; acute treatment for migraine

<p>CD44 antibody (PE) was raised in rat using murine CD44 as the immunogen.</p>

JMJD6 antibody was raised in rabbit using the N terminal of JMJD6 as the immunogen

<p>CALM1 antibody was raised in Rabbit using Human CALM1 as the immunogen</p>

Methyl 5-fluoro-2-(2-(1-methyl-1H-1,2,4-triazol-5-yl)acetyl)-3-nitrobenzoate is a synthetic organic compound, which is derived from aromatic benzoate structures enhanced with fluorine, nitro, and triazole moieties. The source of this compound lies in advanced synthetic chemistry techniques, involving multiple steps that introduce these functional groups to a benzoate core, thereby enhancing its physicochemical properties.

<p>Rabbit polyclonal GPRIN2 antibody</p>

Purified recombinant Dengue NS1 protein (Serotype 4) (His tag)

CD8a antibody (PE-Texas Red) was raised in rat using murine thymus or spleen as the immunogen.

Mouse monoclonal PDE4A antibody

<p>Rabbit polyclonal UBR1 antibody</p>

Basic blue 54 is a methoxylated basic dye with a carbonyl group. It is used as an absorber in the cross-link process and as a polymerization initiator in reactive dyeing. Basic blue 54 has been shown to be reactive with persulfate and undergo an absorption process. Langmuir adsorption isotherms of basic blue 54 indicate that it has good chemical stability. Basic blue 54 is used as a model system for the study of reactive dyes, which are usually high molecular weight compounds that have both hydrophilic and hydrophobic groups.

<p>The Synaptotagmin antibody is a diagnostic reagent used in Life Sciences. It is an antibody that specifically binds to the protein Synaptotagmin, which plays a crucial role in neurotransmitter release. This antibody can be used for various applications, including research on synaptic transmission and the study of neurological disorders. The Synaptotagmin antibody is produced using recombinant cells and has high specificity and sensitivity. It is a valuable tool for scientists and researchers working in the field of neuroscience. Additionally, this antibody can also be used as a medicament for therapeutic purposes, such as targeting specific proteins involved in diseases like botulinum poisoning or calpain-related disorders. With its wide range of applications, the Synaptotagmin antibody is an essential tool for any researcher or clinician working in the field of Life Sciences.</p>

CD105 antibody (biotin) was raised in mouse using membrane preparation of human B-linage leukemia cells as the immunogen.

<p>IGF2BP2 antibody was raised using the middle region of IGF2BP2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS</p>

Anti EGF (Rat) Serum is a research tool that can be used for the detection of protein-protein interactions and receptor-ligand interactions. This serum has a high purity and can be used in cell biology, pharmacology, and life science. Anti EGF (Rat) Serum is an inhibitor that binds to EGFR. It blocks the activation of EGFR by blocking ligand binding to EGFR or by preventing GPCR from activating downstream signaling pathways.

NSC 756093 is a synthetic compound that binds to the cytoskeletal protein tubulin, which is involved in cell division. NSC 756093 can inhibit the movement of the microtubule, leading to disruption of the mitotic spindle and arrest of cell division. This drug has been shown to be effective against resistant cancer cells and may be useful as a chemotherapeutic treatment for cancers such as leukemia or breast cancer.

FES antibody was raised in Mouse using a purified recombinant fragment of FES expressed in E. coli as the immunogen.

<p>Purified Polyclonal AMPK beta 1 antibody</p>

<p>Ofloxacin-d8 is an analog of the fluoroquinolone antibiotic Ofloxacin that contains eight deuterium atoms. It has been shown to have potent anticancer properties in human and Chinese cancer cell lines by inhibiting protein kinases, including cyclin-dependent kinases, which are important regulators of cell division. Ofloxacin-d8 induces apoptosis, a process of programmed cell death that plays a crucial role in preventing tumor growth. This drug can be detected in urine samples and is used as a research tool for studying the pharmacokinetics and metabolism of Ofloxacin. Additionally, it can be used as an inhibitor for kinase assays in cancer research. Overall, Ofloxacin-d8 is a powerful tool for investigating the mechanisms underlying cancer cell growth and developing new anticancer therapies.</p>

<p>SERPINA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA</p>

Prolactin is a protein that is secreted by the anterior pituitary gland. It has many functions, including the stimulation of milk production and the regulation of other hormones. Prolactin Human contains purified human prolactin in a lyophilized powder form. It can be reconstituted with sterile water for injection or bacteriostatic water for injection for use in research or therapeutic applications.

<p>The YPEL5 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the YPEL5 protein, a basic protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

BI-847325 is a new compound that inhibits the expression of genes that are involved in the development of cancer. It has been shown to have a potent inhibitory effect on cell proliferation and pro-apoptotic protein. BI-847325 is orally active, crossing the blood brain barrier in animals, and has a low toxicity profile. BI-847325 inhibits RNA synthesis by binding to the enzyme rRNA polymerase or by inhibiting ribosome activity. This compound also inhibits ATP levels and replication of DNA in liver cells, which may be due to its ability to bind to metagene sequences. BI-847325 has demonstrated promising results in animal studies for gastrointestinal toxicities, with no evidence of weight loss or anorexia at doses up to 15 times higher than the dose required for efficacy against cancer cells.

The CTNNB1 antibody is a highly potent and effective agent used in the field of Life Sciences. This antibody has shown promising results in various applications, including as a serum marker for telomerase activity and interferon-stimulated gene expression. It has also been found to play a crucial role in pluripotent stem cell maintenance and differentiation. Additionally, the CTNNB1 antibody has demonstrated its efficacy as an anti-mesothelin agent, inhibiting the growth of cancer cells expressing this glycoprotein. Its mechanism of action involves targeting glycogen synthase kinase and interfering with key signaling pathways involved in cell proliferation and survival. With its high-flux binding capacity, this monoclonal antibody offers a reliable solution for researchers and clinicians seeking effective medicaments for their studies or therapeutic interventions.

<p>Pi(3,4)P2 is a phospholipid that is found in the membrane of all eukaryotic cells. It is one of the most abundant phospholipids in the cell and can be found in many different forms. Pi(3,4)P2 has been shown to interact with proteins and ion channels as well as being involved in cellular functions such as cell proliferation and migration. Pi(3,4)P2 is a vital research tool for studying how cells respond to stimuli and for identifying new drug targets. Pi(3,4)P2 can be synthesized by reacting 1-palmitoyl-2-oleoyl-sn-glycero-3-[phosphocholine] (PC), 1,1'-bis[di(carboxylatooxy)phosphino]ferrocene (PCF), and lithium diisopropylamide (LDA).</p>

TFC 007 is a small molecule that has been shown to cause cardiac hypertrophy in animals. It binds to the receptor for ubiquitin and the ligand, which are involved in the inflammatory process. TFC 007 is a ligand-binding molecule that activates the ubiquitin-proteasome system, leading to cell death. TFC 007 also inhibits the synthesis of inflammatory cytokines, such as IL-1β and IL-6, by binding to their respective receptors. This inhibition leads to decreased levels of proinflammatory cytokines and reduced cardiac hypertrophy.

A synthetic peptide for use as a blocking control in assays to test for specificity of NPY1R antibody, catalog no. 70R-5940

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

NT13 is a drug that is being developed for the treatment of hepatitis C. It has been shown to inhibit viral replication and may be able to stabilize the virus. NT13 is an analog of the nucleoside analog, ribavirin, and it inhibits viral RNA synthesis by binding to the RNA polymerase enzyme in the virus's ribonucleoprotein complex. NT13 also has antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. It binds to bacterial 16S ribosomal RNA and inhibits protein synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. NT13 also has anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis.

AT-56 is a novel and well-tolerated drug that is used for the treatment of cancer. AT-56 has been shown to inhibit the activity of mineralocorticoid receptor (MR), which is a member of steroid hormone receptors. The MR regulates salt and water balance in the body, so inhibition of this receptor can lead to severe hypertension. AT-56 also has an antiangiogenic effect by inhibiting vascular endothelial growth factor (VEGF) production in endothelial cells. This leads to decreased choroidal neovascularization, which causes blindness due to damage to retinal pigment epithelium cells. AT-56 also induces cell lysis, which may be associated with its ability to induce apoptosis in cancer cells. AT-56 binds to the tumor cell membrane with a high affinity and increases permeability through ion channels, leading to cell lysis and death.

Rabbit polyclonal Collagen XX alpha 1 antibody

Agistatin B is a natural product that inhibits cholesterol biosynthesis by blocking the conversion of hydroxylated lanosterol to cholesterol. Agistatin B is biosynthesized from Fusarium spp. and has been shown to inhibit the growth of Fusarium graminearum, a fungus that causes head blight in wheat and barley. This compound may have applications as an antifungal agent or for the treatment of hypercholesterolemia.

<p>Goat anti human IgG (Fc) (Agarose Conjugated) was raised in goat using human IgG Fc fragment as the immunogen.</p>

<p>Human Serum Albumin (HSA) is a protein that is produced in the liver and helps maintain the osmotic pressure of the blood. It also has anti-inflammatory, immunomodulatory, and anti-coagulant properties. HSA is used as a research tool to study protein interactions and receptor ligand pharmacology. HSA is also used as an activator for antibodies or other enzymes that require activation by a protein. Our plant-produced recombinant HSA is a non-glycosylated, polypeptide chain containing 585 amino acids, and has a molecular mass of 67 kDa.</p>

<p>2,4-Diisopropyl-5-methylphenol is an antipyrine derivative. It is used as a topical antineoplastic drug in the treatment of women with capitata and conformation abnormalities. 2,4-Diisopropyl-5-methylphenol has also been used to treat infantile phaeohyphomycosis caused by Capitata flecainide. The serum level of 2,4-diisopropyl-5-methylphenol is increased during long term administration due to its accumulation in tissues. This accumulation results in neutropenia and other side effects such as nausea and vomiting.</p>

The ATG4D antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working in the area of antibodies and theranostics. This antibody specifically targets the proline-rich protein ATG4D, which plays a crucial role in autophagy, a cellular process involved in maintaining cellular homeostasis.

<p>Hepronicate is a polyunsaturated fatty acid that is a precursor to prostaglandin E1. It is available as a prescription drug and is used for the treatment of symptoms caused by congestive heart failure, diabetic neuropathy, and corneal endothelial cell dysfunction. Hepronicate has also been shown to stimulate the growth of cells in culture and may be an effective treatment for many types of cancer. This drug binds to the polyunsaturated fatty acid receptor on the surface of cells, which leads to an increase in polyunsaturated fatty acids in the cell membrane and activation of protein kinase C. Hepronicate may also inhibit tumor growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication.</p>

<p>Sostenuto (sRANKL) is a cytokine that binds to the activator of the receptor activator of NF-κB ligand. It is a soluble protein that can activate cells and regulate inflammatory responses. Sostenuto has been shown to be an important regulator in the immune system and can stimulate macrophages, T cells, and B cells by binding to their receptors. It also inhibits neutrophil apoptosis and enhances IL-10 production in macrophages. Sostenuto has been shown to have a regulatory effect on bacterial growth, specifically Escherichia Coli which is found in the gut.</p>

<p>Purified Polyclonal CFC1B antibody</p>

Etamicastat hydrochloride is a drug that inhibits the activity of the human liver enzyme CYP2D6. It is an inhibitor of the acetylation of dopamine to noradrenaline, which is important for the synthesis of adrenaline and dopamine. Etamicastat hydrochloride has been shown to have affinity for both human and monkey tissues. It also inhibits hydroxylation in rat plasma, liver cytosol, and liver microsomes. This drug has also been shown to inhibit dopamine hydroxylase in rat brain tissue as well as in vitro studies with human liver preparations. Etamicastat hydrochloride has been found to be effective against Parkinson's disease and other diseases that are associated with a decrease in dopamine levels.

Potent inhibitor of SERCA ATPase

<p>HDAC1 Monoclonal Antibody (FITC)</p>

<p>β2 adrenoreceptor agonist</p>

1-Deoxysphinganine-d3 is an isotopically labeled sphingolipid analog, which is a synthetic derivative of naturally occurring sphingoid bases. It is derived through a process of selective deuterium labeling, replacing hydrogen atoms with deuterium at three specific positions. This modification allows for its use in precise mass spectrometric studies due to the distinct mass difference imparted by deuterium. Its mode of action involves mimicking sphingolipid metabolic pathways, enabling the investigation of sphingolipid-associated functions in cells without influencing the biological activity as a substrate in enzymatic reactions.

<p>RPS16 antibody was raised in rabbit using the N terminal of RPS16 as the immunogen</p>

<p>NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE</p>

<p>L-778123 is a potent, selective inhibitor of Kv1.3 potassium channels with excellent pharmacokinetics and tissue selectivity. It has been used for in vitro research to study the role of ion channels in cell biology and pharmacology, as well as for the development of new drugs to treat diseases such as epilepsy. L-778123 binds to the Kv1.3 channel and inhibits its activity by blocking the flow of potassium ions through it. The binding site on L-778123 is completely different from that on other analogues that have been studied. This peptide can also be used to study protein interactions and antibody activity.</p>

Normal Donkey Serum is a valuable biospecimen used in various life science and veterinary applications. Derived from donkeys, this serum contains a range of important components that make it useful for research purposes. Normal Donkey Serum is commonly used as a blocking agent to prevent non-specific binding of antibodies in immunohistochemistry and immunocytochemistry experiments. It also serves as an essential component in the development of monoclonal antibodies and other cell-based assays. This serum contains various growth factors, such as epidermal growth factor, which can promote cell proliferation and differentiation. Additionally, Normal Donkey Serum contains inhibitors that can modulate specific signaling pathways, including the interferon pathway and the phosphoinositide 3-kinase (PI3K) pathway. Researchers often use Normal Donkey Serum as a control or reference sample in their experiments. Its acidic pH and low hemolysis rate make it suitable for a wide range of applications. Furthermore, its immobilization properties allow for stable electrode

<p>Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen</p>

<p>Inhibits MDM2-p53 interaction</p>

Mouse monoclonal XRCC1 antibody

<p>Human Prorenin ELISA kit is a solid-phase competitive immunoassay for the quantitative measurement of prorenin in human serum. This kit has been designed to provide accurate and reproducible results. The assay employs a monoclonal antibody to the analyte and a polyclonal antiserum that recognizes the analyte. The antibodies are used in an indirect sandwich assay with horseradish peroxidase-conjugated goat anti-mouse IgG as the second antibody.</p>

18:1 TEMPO is a peptide that is used in research as a cell biology and pharmacology tool. It has been shown to be an inhibitor of ion channels, including calcium channels. 18:1 TEMPO also inhibits the activity of the receptor tyrosine kinase, which plays an important role in the regulation of cellular processes such as cell division and differentiation. 18:1 TEMPO is available in high purity at CAS No. 150480-57-2, and has been shown to be a potent activator of ligand binding to some receptors.

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using techniques like patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

Rabbit polyclonal FMN2 antibody

FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

<p>Deuterium-labelled internal standard for paclitaxel</p>

<p>ACTH 4-11 is a synthetic peptide with the amino acid sequence of ACTH(1-14) that inhibits the binding of ACTH to its receptor. It has been used as a research tool to study the interactions between ACTH and its receptor. Research has shown that ACTH 4-11 can activate the receptor, and it is being studied as a potential treatment for conditions such as chronic pain. The peptide is also being investigated for use in the treatment of obesity, Alzheimer's disease, Parkinson's disease, and other neurological disorders.</p>

<p>KX2-391 is a peptide inhibitor of the protein tyrosine phosphatases PTP1B and SHP-2. KX2-391 binds to the active site of PTP1B, which is located in the cytoplasm. This binding blocks the dephosphorylation of various substrates including phosphotyrosine residues on proteins such as insulin receptor substrate 1 (IRS-1), thereby preventing signaling pathways that are mediated by tyrosine kinase activity. KX2-391 also inhibits SHP-2, a protein tyrosine phosphatase that regulates cellular proliferation and differentiation.<br>KX2-391 has been shown to activate protein kinase C (PKC) and cAMP response element binding protein (CREB). KX2-391 can be used as a research tool for studying PKC and CREB activation, or as an antibody for immunohistochemistry studies.</p>

OVA conjugated Ractopamine Hapten

CD3e antibody (biotin) was raised in mouse using porcine CD3e as the immunogen.

Please enquire for more information about (D-Ser4,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page

BMP 7 is a cytokine that belongs to the transforming growth factor beta (TGF-β) superfamily. It is produced by many cell types, including E. coli, in response to TGF-β and IL-1. BMP 7 has been shown to be involved in the regulation of cell proliferation and differentiation. BMP 7 has also been shown to be a potent inducer of cytokines such as IL-8, IL-6, IL-1β, and TNF-α from human mononuclear cells.

<p>The IL16 antibody is a powerful tool in the field of Life Sciences. It is an interferon that plays a crucial role in various biological processes. This polyclonal antibody targets IL16, which is involved in the regulation of immune responses and inflammation. The IL16 antibody can be used for applications such as immunoassays, immunohistochemistry, and Western blotting.</p>

<p>Rabbit polyclonal SRPR antibody</p>

<p>Quassinoids are a group of natural products that have been found in plants of the Simaroubaceae family. One example is 14,15-β-dihydroxyklaineanone. Quassinoids are biologically active compounds that have shown to have antiviral and cytotoxic properties. 14,15-β-Dihydroxyklaineanone has been found to inhibit the growth of a number of viruses including HIV, herpes simplex virus type 1, and influenza A virus. The extract of this compound has also been used for the treatment of leishmaniasis, an inflammatory disease caused by parasitic protozoa from the genus Leishmania. There is still much to be learned about the toxicity and safety profile of quassinoids as well as their analytical methods.</p>

<p>Rat monoclonal CD4 antibody (allophycocyanin); IgG2a kappa; clone RM4-5</p>

CLIC3 antibody was raised in rabbit using the N terminal of CLIC3 as the immunogen

<p>Please enquire for more information about 1-Undecanoyl-2-hydroxy-sn-glycero-3-phosphocholine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Fulacimstat is a drug that is used to treat chronic kidney disease and ventricular dysfunction. Fulacimstat blocks angiotensin II, which is a potent vasoconstrictor, by inhibiting the angiotensin-converting enzyme (ACE). It has been shown to have beneficial effects on cardiac function in patients with chronic kidney disease who are undergoing hemodialysis. Fulacimstat has also been shown to reduce blood pressure in patients with renal impairment. Fulacimstat lowers potassium levels and increases serum levels of renin, which may lead to adverse events such as infarction or hyperkalemia. Fulacimstat may be an effective treatment for heart failure, but the safety profile needs to be further investigated before it can be recommended for this use.

Rab11B antibody was raised in Rat using Mouse RAB11B and GST fusion protein as the immunogen.

<p>Rabbit polyclonal TGF beta 3 antibody</p>

<p>Hydroxypyruvic acid lithium hydrate is a research tool that can be used to study the interaction of peptides with antibodies and receptor proteins. It is also used as an activator for the production of antibodies. This product is a white powder that is soluble in water and alcohol. CAS No. 209728-15-4</p>

Purified Rabbit polyclonal RPC5 antibody

Mouse monoclonal DNTTIP1 antibody

<p>CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.</p>

Saikogenin A is a natural compound found in the tuberous roots of Pueraria lobata that has been shown to have a variety of biological activities. Saikogenin A inhibits protein synthesis through a number of mechanisms, including interfering with the production of growth factors, blocking the conversion of epoxyeicosatrienoic acids to prostaglandins, and inhibiting the activity of human liver cancer cells. It also has anti-inflammatory properties and has been shown to inhibit UV absorption as well as erythromycin-induced uvB damage in human skin cells. The triple-quadrupole mass spectrometry analysis reveals that saikogenin A has absorptions at 336, 338, and 340 nm in urine samples. This suggests that saikogenin A may be metabolized by cytochrome P450 enzymes into metabolites with different absorption spectra.

The VGLL1 antibody is a highly specific monoclonal antibody that targets mesothelin, a serum albumin protein. It is widely used in the field of Life Sciences for various research applications. This antibody has been shown to effectively detect and quantify mesothelin levels in biological samples, making it an invaluable tool for studying its expression and function. Additionally, the VGLL1 antibody has been proven to modulate glutamate signaling and regulate e-cadherin expression, which are essential processes in cellular communication and adhesion. Furthermore, this antibody has demonstrated interactions with other important proteins such as osteopontin, oncostatin, and β-catenin, suggesting its involvement in multiple signaling pathways. The VGLL1 antibody is available as both monoclonal and polyclonal antibodies and is compatible with human serum samples. With its high specificity and ability to activate downstream signaling pathways, the VGLL1 antibody is an indispensable resource for researchers in various fields of study.