Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.117 produits)
- Par Biological Target(99.161 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.710 produits)
- Métabolites secondaires(14.222 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Degré de pureté :Min. 95%Human B2M ELISA Kit
<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Mouse SAP ELISA Kit
<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%Human Transferrin ELISA Kit
<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>Degré de pureté :Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Degré de pureté :Min. 95%Mouse NGAL ELISA Kit
<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey Plasminogen ELISA Kit
<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>Degré de pureté :Min. 95%Mouse Retinol Binding Protein ELISA Kit
<p>Mouse Retinol Binding Protein ELISA Kit</p>Degré de pureté :Min. 95%Cysteine
<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>Formule :C32H50O9N10S1Masse moléculaire :750.87 g/molHuman Apolipoprotein A1 ELISA Kit
<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat CRP ELISA Kit
<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse CRP ELISA Kit
<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey IgM ELISA Kit
<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>Degré de pureté :Min. 95%HO1, gst tagged human
CAS :<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>Degré de pureté :Min. 95%AMC
CAS :<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END></p>Formule :C10H9NO2Degré de pureté :Min. 95%Masse moléculaire :175.18 g/molFerumoxytol
CAS :<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>Formule :Fe3H2O4Degré de pureté :Min. 95%Masse moléculaire :233.55 g/molSodium pyrophosphate decahydrate
CAS :<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>Formule :H4O7P2•Na4•(H2O)10Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :450.09 g/molMouse IgM ELISA Kit
<p>Please enquire for more information about Mouse IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Acetic acid-13C2, d3
CAS :Produit contrôlé<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C2H4O2Degré de pureté :Min. 95%PQR626
CAS :<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>Formule :C20H25F2N7O2Degré de pureté :Min. 95%Masse moléculaire :433.5 g/molSLV-2436
CAS :<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>Formule :C19H15ClN4ODegré de pureté :Min. 95%Masse moléculaire :350.8 g/molHuman LRG1 ELISA Kit
<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>Degré de pureté :Min. 95%Guinea Pig IgG ELISA Kit
<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control Fc fusion protein (PE)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>Degré de pureté :Min. 95%IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Degré de pureté :Min. 95%Cortisol ELISA kit
<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>Degré de pureté :Min. 95%Rat Estradiol ELISA kit
<p>ELISA Kit for detection of Estradiol antibody in the research laboratory</p>Degré de pureté :Min. 95%CD30 antibody (FITC)
<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Degré de pureté :Min. 95%SARS-CoV-2 N (IgG) Ab ELISA Kit
<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>Degré de pureté :Min. 95%Human Growth Hormone ELISA Kit
<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>Degré de pureté :Min. 95%Triiodothyronine ELISA Kit
<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Dequalinium chloride hydrate
CAS :<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>Formule :C30H40N4•Cl2•(H2O)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :545.6 g/molHuman TRAIL ELISA kit
<p>ELISA kit for the detection of TRAIL in the research laboratory</p>Degré de pureté :Min. 95%Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Recombinant Human VEGF-C
<p>Human sequence expressed in CHO Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Rabbit anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Degré de pureté :Min. 95%Horse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Degré de pureté :Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Degré de pureté :Min. 95%Human ICAM1 ELISA kit
<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>Degré de pureté :Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Big Endothelin-1 (Human, 1-38)
CAS :<p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>Formule :C189H282N48O56S5Degré de pureté :Min. 95%Masse moléculaire :4,282.9 g/molDopamine ELISA kit
<p>ELISA kit for the detection of Dopamine in the research laboratory</p>Degré de pureté :Min. 95%CP-724714
CAS :<p>CP-724714 is a small molecule that is able to inhibit the growth of cancer cells. It has been shown to be effective against HER2+ breast cancer, colorectal carcinoma cell lines, and lung carcinoma cell lines. CP-724714 causes cell cycle arrest by inhibiting the production of proteins required for DNA replication and repair. Cell proliferation inhibition can also be achieved by blocking epidermal growth factor receptors or other growth factors such as platelet-derived growth factor (PDGF). The mechanism of action may involve interference with the activation of protein kinase B (PKB), which is involved in cell signaling pathways. CP-724714 has been studied in both cell culture and clinical studies for its biological function as a cancer therapeutic agent.</p>Formule :C27H27N5O3Degré de pureté :Min. 95%Masse moléculaire :469.53 g/molCat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Degré de pureté :Min. 95%Mouse Neurotrophin 3 ELISA Kit
<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgG2C ELISA Kit
<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>Degré de pureté :Min. 95%Hamster (CHO) Glutathione S-Transferase P - ELISA Kit
<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>Degré de pureté :Min. 95%Mouse IgG ELISA kit
<p>ELISA Kit for detection of IgG in the research laboratory</p>Degré de pureté :Min. 95%Mouse MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Degré de pureté :Min. 95%MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Degré de pureté :Min. 95%Human SCF ELISA kit
<p>ELISA Kit for detection of SCF in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Degré de pureté :Min. 95%Rat Hemoglobin ELISA Kit
<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse PGD2 ELISA kit
<p>ELISA Kit for detection of PGD2 in the research laboratory</p>Degré de pureté :Min. 95%Influenza A Calibration Kit
<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>Degré de pureté :Min. 95%Rat MIP3 α ELISA Kit
<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>Degré de pureté :Min. 95%Rat Lipocalin 2 ELISA Kit
<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>Degré de pureté :Min. 95%Coronavirus (SARS-CoV-2) Nucleoprotein - Purified
<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>Degré de pureté :Min. 95%Bovine Haptoglobin ELISA Kit
<p>Please enquire for more information about Bovine Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%PBB 10
CAS :<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>Formule :C12H8Br2Degré de pureté :Min. 95%Masse moléculaire :312 g/molHuman Ceruloplasmin ELISA Kit
<p>Human Ceruloplasmin ELISA kit is intended for the quantitative determination of total human ceruloplasmin in biological samples.</p>Degré de pureté :Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgE ELISA Kit
<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Degré de pureté :Min. 95%SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control antibody (Biotin)
<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>Degré de pureté :Min. 95%Human IgM ELISA kit
<p>ELISA Kit for detection of IgM in the research laboratory</p>Degré de pureté :Min. 95%Neurokinin A (Human, Porcine, Rat, Mouse)
<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>Formule :C50H80N14O14S•2CH3COOH•5H2ODegré de pureté :Min. 95%Masse moléculaire :1,343.48 g/molβ-Sinensal
CAS :<p>β-Sinensal is an analog of astaxanthin that has shown potent inhibitory activity against human kinases. This compound has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamsters. β-Sinensal has also been found in human urine, suggesting that it may have a role in regulating cellular replication. In addition, this compound has demonstrated synergistic effects with methotrexate, a commonly used cancer drug. β-Sinensal is a promising inhibitor of kinases and may have potential as a therapeutic agent for the treatment of cancer.</p>Formule :C15H22ODegré de pureté :Min. 95%Masse moléculaire :218.33 g/molMouse IL16 ELISA kit
<p>ELISA Kit for detection of IL16 in the research laboratory</p>Degré de pureté :Min. 95%Human TARC ELISA kit
<p>ELISA Kit for detection of TARC in the research laboratory</p>Degré de pureté :Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Degré de pureté :Min. 95%Thymus factor X
CAS :<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>Degré de pureté :Min. 95%Masse moléculaire :1,000 g/molTAPI-2
CAS :<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>Formule :C19H37N5O5Degré de pureté :Min. 95%Masse moléculaire :415.53 g/molHuman TIMP2 ELISA Kit
<p>ELISA kit for detection of TIMP2 in the research laboratory</p>Degré de pureté :Min. 95%Histamine in Foodstuffs ELISA kit
<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>Degré de pureté :Min. 95%Peptide YY(3-36), PYY, human
<p>Custom research peptide; min purity 95%.</p>Formule :C180H279N53O54Degré de pureté :Min. 95%Masse moléculaire :4,049.55 g/molMouse KIM-1 ELISA Kit
<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Bovine IgG ELISA Kit
<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>Degré de pureté :Min. 95%Progesterone ELISA Kit
<p>ELISA kit for detection of Progesterone in the research laboratory</p>Degré de pureté :Min. 95%Prothrombin screen ELISA kit
<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>Degré de pureté :Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Bisoprolol
CAS :<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>Formule :C22H35NO8Degré de pureté :Min. 95%Masse moléculaire :441.50 g/molPig Haptoglobin ELISA Kit
<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat Albumin ELISA Kit
<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse Hemoglobin ELISA Kit
<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Degré de pureté :Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Degré de pureté :Min. 95%Human TNF α ELISA kit
<p>ELISA kit for the detection of TNF alpha in the research laboratory</p>Degré de pureté :Min. 95%Bovine IgM ELISA kit
<p>ELISA Kit for detection of IgM in the research laboratory</p>Degré de pureté :Min. 95%Human Haptoglobin ELISA Kit
<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rubella ELISA Kit
<p>ELISA kit for detection of Rubella in the research laboratory</p>Degré de pureté :Min. 95%Mouse IL2 ELISA kit
<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>Degré de pureté :Min. 95%Thyroglobulin ELISA kit
<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Lactoferrin ELISA kit
<p>ELISA kit for the detection of Lactoferrin in the research laboratory</p>Degré de pureté :Min. 95%Rabbit Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Degré de pureté :Min. 95%Dog KIM-1 ELISA Kit
<p>Please enquire for more information about Dog KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Salivary Sample Collection Kit
<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgA ELISA kit
<p>ELISA Kit for detection of IgA in the research laboratory</p>Degré de pureté :Min. 95%Human HGF ELISA kit
<p>ELISA kit for the detection of Human HGF in the research laboratory</p>Degré de pureté :Min. 95%Mouse C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Gliadin IgG ELISA kit
<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>Degré de pureté :Min. 95%HCG ELISA kit
<p>ELISA Kit for detection of HCG in the research laboratory</p>Degré de pureté :Min. 95%Human IL1 β ELISA kit
<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>Degré de pureté :Min. 95%Rat IGF1 ELISA Kit
<p>ELISA kit for detection of IGF1 in the research laboratory</p>Degré de pureté :Min. 95%LGALS1 protein (His tag)
<p>Purified recombinant LGALS1 protein (His tag)</p>Degré de pureté :Min. 95%Calcitonin ELISA kit
<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>Degré de pureté :Min. 95%Human Plasminogen ELISA Kit
<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rapalink-1
CAS :<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>Formule :C91H138N12O24Degré de pureté :Min. 95%Masse moléculaire :1,784.1 g/molDog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Degré de pureté :Min. 95%CMV ELISA Kit
<p>ELISA kit for detection of CMV in the research laboratory</p>Degré de pureté :Min. 95%CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>Human Lipocalin 2 ELISA kit
<p>ELISA kit for the detection of NGAL in the research laboratory</p>Degré de pureté :Min. 95%Rat CRP ELISA kit
<p>ELISA kit for the detection of Rat CRP in the research laboratory</p>Degré de pureté :Min. 95%Dysprosium(III) bromide
CAS :<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>Formule :Br3DyDegré de pureté :Min. 95%Masse moléculaire :402.21 g/molMyeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>Decorsin
<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of > 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>Formule :C179H271N55O62S6Degré de pureté :Min. 95%Masse moléculaire :4,377.8 g/molBovine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>Human C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Degré de pureté :Min. 95%Human CXCL10 ELISA Kit
<p>ELISA kit for detection of CXCL10 in the research laboratory</p>Degré de pureté :Min. 95%Human Mullerian hormone ELISA kit
<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>Degré de pureté :Min. 95%Cat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Degré de pureté :Min. 95%Hamster CHO PLBL2 ELISA Kit
<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>Degré de pureté :Min. 95%SSA ELISA kit
<p>ELISA kit for the detection of SSA in the research laboratory</p>Degré de pureté :Min. 95%Grams iodine stain
CAS :<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>Formule :I3K3Degré de pureté :Min. 95%Masse moléculaire :498.01 g/molPSA ELISA Kit
<p>ELISA kit for detection of PSA in the research laboratory</p>Degré de pureté :Min. 95%Mesotocin trifluroacetate
CAS :<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.19 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/molHead activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%Myelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/mol[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/mol
