Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.084 produits)
- Par Biological Target(99.070 produits)
- Par usage/effets pharmacologiques(6.784 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.217 produits)
130573 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
N,N,N-Trimethylethylenediamine pure, 97%
CAS :Formule :C5H14N2Degré de pureté :min. 97%Couleur et forme :Clear, Colourless, LiquidMasse moléculaire :102.18Hexane Sulphonic Acid Sodium Salt Anhydrous for HPLC, 99%
CAS :Formule :C6H13SO3NaDegré de pureté :min. 99 %Couleur et forme :White, Crystalline powder, Clear, Colourless, Clear, ColourlessMasse moléculaire :188.24Pentylenetetrazole (Pentetrazole) extrapure, 99%
CAS :Formule :C6H10N4Degré de pureté :min. 99%Couleur et forme :White to off-white, Crystalline powder, ClearMasse moléculaire :138.171,4-Dioxane scintillation grade, 99.5%
CAS :Formule :C4H8O2Degré de pureté :min. 99.5%Couleur et forme :Clear, Colourless, Liquid, max. 10Masse moléculaire :88.115-Hydroxy-L-Tryptophan extrapure, 98%
CAS :Formule :C11H12N2O3Degré de pureté :min. 99%Couleur et forme :White to off - white to pale brown, PowderMasse moléculaire :220.23Hygromycin B (HGR), 90%
CAS :Formule :C20H37N3O13Degré de pureté :min. 90%Couleur et forme :White to off - white, PowderMasse moléculaire :527.52Forchlorfenuron (KT-30, CPPU, N-(2-Chloro-4-pyridyl)-N-phenylurea) extrapure, 99%
CAS :Formule :C12H10ClN3ODegré de pureté :min. 99%Couleur et forme :White, Crystalline powderMasse moléculaire :247.68Thiomersal (Thimerosal) ExiPlus, Multi-Compendial, 98%
CAS :Formule :C9H9SO2HgNaDegré de pureté :min. 98%Couleur et forme :White to pale cream, Powder, Clear, Colourless to pale yellowMasse moléculaire :404.81Valinomycin, 95%
CAS :Formule :C54H90N6O18Degré de pureté :min. 95%Couleur et forme :White, Crystalline powderMasse moléculaire :1111.340% Acrylamide / Bis-acrylamide Mix Solution (Ratio: 37.5:1)
Couleur et forme :Clear, Colourless, LiquidLugdunin
CAS :<p>Lugdunin is a synthetic antibiotic that has been shown to inhibit the growth of bacteria by binding to the cell membrane. This binding causes a change in membrane potential, leading to inhibition of bacterial growth and death. Lugdunin is effective against Staphylococcus aureus, including methicillin-resistant strains, and has been found to be safe for use in humans. It is also active against other Gram-positive bacteria such as Streptococcus pneumoniae and Enterococcus faecalis. The enantiomer of lugdunin does not have antibacterial activity.</p>Formule :C40H62N8O6SDegré de pureté :Min. 95%Masse moléculaire :783.05 g/molTris(2-carboxyethyl) Phosphine Hydrochloride (TCEP) extrapure AR, 98%
CAS :Formule :C9H15O6P·HClDegré de pureté :min. 98%Couleur et forme :White, Crystalline powderMasse moléculaire :286.65Urea ACS, 99.5%
CAS :Formule :CH4N2ODegré de pureté :min. 99.5%Couleur et forme :White, Crystalline powder, Clear, ColourlessMasse moléculaire :60.06Cyanogen Bromide ExiPlus, Multi-Compendial, 98%
CAS :Formule :CNBrDegré de pureté :min. 98%Couleur et forme :White, Crystalline compoundMasse moléculaire :105.94Acrylamide / Bis-acrylamide Premix Powder, Ratio 19:1
Couleur et forme :White, Crystalline powder, Clear, Colourless5-Fluorouracil (5-FU) Exiplus, Multi-Compendial, 99%
CAS :Formule :C4H3FN2O2Degré de pureté :min. 99%Couleur et forme :White to off white, Crystalline powder, Clear, ColourlessMasse moléculaire :130.08S-Acetylthiocholine Iodide extrapure AR, 99%
CAS :Formule :C7H16NOSIDegré de pureté :min. 99%Couleur et forme :White to off - white, Crystalline powder, ClearMasse moléculaire :289.17Polyoxyethylene (9) Nonylphenylether Branched (IGEPAL CO-630) for molecular biology
CAS :Formule :(C2H4O)n·C15H24O(nCouleur et forme :Clear, Colourless to very faint yellow, LiquidMasse moléculaire :~617Octylphenyl Polyethylene Glycol (IGEPAL CA-630®) for molecular biology
CAS :Formule :(C2H4O)nC14H22OCouleur et forme :Clear, Colourless, Viscous SolutionPyruvic Acid pure, 98%
CAS :Formule :C3H4O3Degré de pureté :min. 98%Couleur et forme :Clear, Colourless to pale yellow, LiquidMasse moléculaire :88.06N-Ethylmaleimide extrapure, 99%
CAS :Formule :C6H7NO2Degré de pureté :min. 99%Couleur et forme :White to off-white to pale yellow, Crystalline powder / CrystalsMasse moléculaire :125.13Phenol:Chloroform:Isoamyl Alcohol (49.5:49.5:1) pH 6.7 for molecular biology
Couleur et forme :Clear, Pale yellow to yellow, LiquidLavender oil extrapure, 30-60% LA
CAS :Degré de pureté :Linalyl acetate 30 - 60%Couleur et forme :Colourless to pale yellow, LiquidFMOC-N-Trityl-L-Asparagine (FMOC-Asn(Trt)-OH) extrapure, 99%
CAS :Formule :C38H32N2O5Degré de pureté :min. 99%Couleur et forme :White to off-white, Crystalline powderMasse moléculaire :596.675-Chloro-7-Iodo-8-Quinolinol (Clioquinol, Iodochlorohydroxyquinoline) ExiPlus, Multi-Compendial, 97-103%
CAS :Formule :C9H5ClINODegré de pureté :97.0-103.0%Couleur et forme :White to Light Yellow to Light Beige, Powder or Crystals, ClearMasse moléculaire :305.5Sucrose pure
CAS :Formule :C12H22O11Couleur et forme :White, Crystalline powder, Clear, ColourlessMasse moléculaire :342.30Palmitoyl Chloride pure, 98%
CAS :Formule :C16H31ClODegré de pureté :min. 98%Couleur et forme :Clear, Colourless to yellow, LiquidMasse moléculaire :274.87Paclobutrazol pure, 95%
CAS :Formule :C15H20ClN3ODegré de pureté :min. 97%Couleur et forme :White to off-white, PowderMasse moléculaire :293.792-Deoxyadenosine Monohydrate extrapure, 98%
CAS :Formule :C10H13N5O3·H2ODegré de pureté :min. 98%Couleur et forme :White, Crystalline powderMasse moléculaire :269.26Phenol:Chloroform:Isoamyl Alcohol (25:24:1) pH 8.0 for molecular biology
CAS :Couleur et forme :Clear, Pale yellow, Liquid4-Amino-3-Hydrazino-5-Mercapto-1,2,4-Triazole (AHMT), 98%
CAS :Formule :C2H6N6SDegré de pureté :min. 98%Couleur et forme :White, Powder, PurpleMasse moléculaire :146.17Phenol Crystalline for molecular biology, 99.5%
CAS :Formule :C6H6ODegré de pureté :min.99.5%Couleur et forme :White, crystalline compoundMasse moléculaire :94.11Triton X-100 extrapure for scintillation
CAS :Couleur et forme :Clear, Colourless to pale yellow, Liquid, max. 50, 63 - 69°CL-Thioproline extrapure, 98%
CAS :Formule :C4H7NO2SDegré de pureté :min. 98%Couleur et forme :White to off - white, Crystalline powderMasse moléculaire :133.17Chlorocholine Chloride (CCC) extrapure, 98%
CAS :Formule :C5H13Cl2NDegré de pureté :min. 98%Couleur et forme :White to off-white, Powder, Clear, Colourless to pale yellowMasse moléculaire :158.07Potassium Ricinoleate extrapure
CAS :Formule :C18H33KO3Couleur et forme :White to off white, Crystalline powder, ClearMasse moléculaire :336.555-(Ethylthio)-1H-Tetrazole (ETT Activator) extrapure, 99%
CAS :Formule :C3H6N4SDegré de pureté :min. 99%Couleur et forme :White, Crystalline powder, Clear, ColourlessMasse moléculaire :130.17New Methylene Blue N Zinc Chloride Double Salt for tissue culture, 90%
CAS :Formule :C18H22N3SClZnCl2Masse moléculaire :416.05Adenine extrapure, 98%
CAS :Formule :C5H5N5Degré de pureté :min.98%Couleur et forme :White to off-white, Crystalline powder, Clear, Colourless to pale yellowMasse moléculaire :135.13Naphthalene scintillation grade, 99%
CAS :Formule :C10H8Degré de pureté :min. 99%Couleur et forme :White, Crystalline powder, Clear, Colourless, Clear, ColourlessMasse moléculaire :128.165-Fluorouracil (5-FU) extrapure, 99%
CAS :Formule :C4H3FN2O2Degré de pureté :min. 99%Couleur et forme :White to off white, Crystalline powder, Clear, ColourlessMasse moléculaire :130.08Dopamine Hydrochloride (Dopamine HCl) extrapure, 98%
CAS :Formule :(HO)2C6H3CH2CH2NH2·HClDegré de pureté :min. 98%Couleur et forme :White to off - white, Crystalline powder, ClearMasse moléculaire :189.642-Bromo-2-Nitro-1,3-Propanediol (Bronopol, BNPD) ExiPlus, Multi-Compendial, 99-101%
CAS :Formule :C3H6BrNO4Degré de pureté :99 - 101%Couleur et forme :White or almost white, Crystalline powder, Clear, ColourlessMasse moléculaire :199.99Polyoxyethylene (5) Nonylphenylether Branched (IGEPAL CO-520) for molecular biology
CAS :Formule :(C2H4O)n·C15H24O(nCouleur et forme :Clear, Colourless, Viscous liquidMasse moléculaire :~441Zinc Chloride for tissue culture, 98%
CAS :Formule :ZnCl2Degré de pureté :min. 98%Couleur et forme :White deliquescent, Granular powderMasse moléculaire :136.29Phenylmethane Sulphonyl Fluoride (PMSF) for molecular biology, 99%
CAS :Formule :C7H7FO2SDegré de pureté :min. 99%Couleur et forme :White to off-white, Crystalline powder, ClearMasse moléculaire :174.20Sulfadiazine (SFD) extrapure, 99-101%
CAS :Formule :C10H10N4O2Degré de pureté :min. 99 - 101%Couleur et forme :White to off white or pinkish white, Powder, ClearMasse moléculaire :250.28Zika Virus Envelope Antigen Mouse Monoclonal Antibody
<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.</p> <p>The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>N,N-Bis(carboxymethyl-13C)-L-alanine
CAS :Produit contrôléFormule :C513C2H11NO6Couleur et forme :Off White SolidMasse moléculaire :273.10Glyceryl Trihexadecanoate-13C1 (2-Hexadecanoate-1-13C)
CAS :Produit contrôlé<p>Applications Glyceryl Trihexadecanoate-13C1 (2-Hexadecanoate-1-13C) is a useful isotopically labeled compound of Tripalmitin (T808130)<br></p>Formule :CC50H98O6Couleur et forme :NeatMasse moléculaire :808.33HBTU
CAS :<p>Applications HBTU is a coupling reagent used in peptide synthesis. HBTU has been shown to effectively suppress racemization.<br>References Prasad, K.V.S.R.G. et al.: Int. J. Pharm. Sci. Rev. Res., 8, 108 (2011); Van Den Nest, W, et al.: J. Pep. Sci., 7, 115 (2001);<br></p>Formule :C11H16F6N5OPCouleur et forme :White To Off-WhiteMasse moléculaire :379.242-Oleoyl-sn-glycero-3-phosphocholine
CAS :Produit contrôlé<p>Applications An intermediate in the biosynthesis of triacylglycerols by castor microsomes.<br>References Yu, S., et al.: J. Agric. Food Chem., 54, 4482 (2006), Lessig, J., et al.: J. Lipid Res., 48, 1316 (2007),<br></p>Formule :C26H52NO7PCouleur et forme :NeatMasse moléculaire :521.67(4R)-Tegoprazan
CAS :Produit contrôléFormule :C20H19F2N3O3Couleur et forme :NeatMasse moléculaire :387.38N,N,N-Trimethylglycine N-Hydroxysuccinimide Ester Bromide
CAS :Produit contrôléFormule :C9H15N2O4·BrCouleur et forme :NeatMasse moléculaire :295.135-Allyl-1-methoxy-2,3-dihydroxybenzene (>90%)
CAS :Produit contrôléFormule :C10H12O3Degré de pureté :>90%Couleur et forme :NeatMasse moléculaire :180.201Diisopropylammonium Tetrazolide
CAS :Produit contrôléFormule :C6H15N·CH2N4Couleur et forme :Off-WhiteMasse moléculaire :171.2433-((2-Chlorothiazol-5-yl)methyl)-5-methyl-1,3,5-oxadiazinan-4-imine Hydrochloride
CAS :Produit contrôlé<p>Applications 3-((2-Chlorothiazol-5-yl)methyl)-5-methyl-1,3,5-oxadiazinan-4-imine Hydrochloride is an intermediate for the synthesis of N-(3-((2-Chlorothiazol-5-yl)methyl)-5-methyl-1,3,5-oxadiazinan-4-ylidene)benzenesulfonamide (C385860), which is an impurity of Thiamethoxam (T344180), a neonicotinoid insecticide.<br>References Oliver, J., et al.: J. Environ. Horticult., 28, 135 (2010), Ghosh, A., et al.: J. Entomol. Res., 34, 35 (2010), Chem. and Eng. News 90: 10 (2012)<br></p>Formule :C8H11ClN4OS·ClHCouleur et forme :NeatMasse moléculaire :283.178Mouse IgG1 ELISA Kit
<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgE ELISA Kit
<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat A2M ELISA Kit
<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rabbit Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Degré de pureté :Min. 95%Bovine IgG ELISA Kit
<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>Degré de pureté :Min. 95%SSA ELISA kit
<p>ELISA kit for the detection of SSA in the research laboratory</p>Degré de pureté :Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Degré de pureté :Min. 95%p-Perfluoroterphenyl
CAS :<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>Formule :C18F14Degré de pureté :Min. 95%Masse moléculaire :482.2 g/molMouse Hemoglobin ELISA Kit
<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgA ELISA kit
<p>ELISA Kit for detection of IgA in the research laboratory</p>Degré de pureté :Min. 95%Monkey IgG ELISA Kit
<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Hamster CHO Legumain ELISA Kit
<p>Hamster (CHO) Legumain ELISA Kit<br>Â <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>Degré de pureté :Min. 95%Human VEGF ELISA kit
<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>Degré de pureté :Min. 95%CHO LPLA2 ELISA Kit
<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog Albumin ELISA Kit
<p>For the quantitative determination of canine/dog albumin in biological samples.</p>Degré de pureté :Min. 95%GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Glucagon (Human, Rat, Mouse)-EIA Kit (1ea)
<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>Degré de pureté :Min. 95%Mouse Vasopressin ELISA kit
<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>Degré de pureté :Min. 95%AMC
CAS :<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END></p>Formule :C10H9NO2Degré de pureté :Min. 95%Masse moléculaire :175.18 g/molHamster CHO Clusterin ELISA Kit
<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Degré de pureté :Min. 95%Bovine CRP ELISA Kit
<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>Degré de pureté :Min. 95%Mouse Fibrinogen ELISA Kit
<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog SAA ELISA Kit
<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>Degré de pureté :Min. 95%Human Angiostatin K13 ELISA Kit
<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>Degré de pureté :Min. 95%H-MEVGWYRPPFSRVVHLYRNGK-OH
<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>Human IL4 ELISA Kit
<p>ELISA kit for detection of Human IL4 in the research laboratory</p>Degré de pureté :Min. 95%Rat AVP ELISA kit
<p>ELISA Kit for detection of AVP in the research laboratory</p>Degré de pureté :Min. 95%Bovine IgM ELISA kit
<p>ELISA Kit for detection of IgM in the research laboratory</p>Degré de pureté :Min. 95%Gliadin IgG ELISA kit
<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>Degré de pureté :Min. 95%Rat IGF1 ELISA Kit
<p>ELISA kit for detection of IGF1 in the research laboratory</p>Degré de pureté :Min. 95%Human CX3CL1 ELISA Kit
<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>Degré de pureté :Min. 95%Rat IgG ELISA kit
<p>ELISA Kit for detection of IgG in the research laboratory</p>Degré de pureté :Min. 95%Dengue Virus IgM ELISA kit
<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>Degré de pureté :Min. 95%Porcine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%Dihydrotestosterone ELISA Kit
<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>Degré de pureté :Min. 95%Fish Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Degré de pureté :Min. 95%Mouse Leptin Receptor ELISA kit
<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>Degré de pureté :Min. 95%Human PGF2a ELISA kit
<p>ELISA Kit for detection of PGF2a in the research laboratory</p>Degré de pureté :Min. 95%CMV ELISA Kit
<p>ELISA kit for detection of CMV in the research laboratory</p>Degré de pureté :Min. 95%Thyroglobulin ELISA kit
<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>Degré de pureté :Min. 95%Rheumatoid Factor IgM ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>Degré de pureté :Min. 95%Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>Thyroxine ELISA Kit
<p>ELISA kit for detection of Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%Chicken SAA ELISA Kit
<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>Degré de pureté :Min. 95%Dog IgA ELISA Kit
<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human IgE ELISA Kit
<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%PR3 ELISA kit
<p>ELISA kit for the detection of PR3 in the research laboratory</p>Degré de pureté :Min. 95%Rubella ELISA Kit
<p>ELISA kit for detection of Rubella in the research laboratory</p>Degré de pureté :Min. 95%Porcine IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Degré de pureté :Min. 95%Canine MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Degré de pureté :Min. 95%Jo1 ELISA kit
<p>ELISA kit for the detection of Jo1 in the research laboratory</p>Degré de pureté :Min. 95%Mouse MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO β 2-Microglobulin (B2M) ELISA Kit
<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Rat Hemoglobin ELISA Kit
<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Bovine IgG ELISA Kit
<p>The Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG in biological samples.</p>Degré de pureté :Min. 95%Human B2M ELISA Kit
<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Mouse SAP ELISA Kit
<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Guinea Pig IgG ELISA Kit
<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>Degré de pureté :Min. 95%Human LRG1 ELISA Kit
<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>Degré de pureté :Min. 95%Rat Clusterin ELISA Kit
<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Degré de pureté :Min. 95%Human C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Monkey C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Mouse NGAL ELISA Kit
<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey Plasminogen ELISA Kit
<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>Degré de pureté :Min. 95%Monkey IgA ELISA Kit
<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Fish Thyroxine ELISA kit
<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>Rat Free Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Rat Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Degré de pureté :Min. 95%Rituximab Light chain (41-55)
<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>Masse moléculaire :1,620.8 g/molToxoplasma gondii IgG ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>Degré de pureté :Min. 95%CRP ELISA kit
<p>ELISA kit for the detection of CRP in the research laboratory</p>Degré de pureté :Min. 95%Canine Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Degré de pureté :Min. 95%Calcitonin ELISA kit
<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>Degré de pureté :Min. 95%Cortisol ELISA kit
<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>Degré de pureté :Min. 95%Human OPN ELISA Kit
<p>ELISA kit for detection of OPN in the research laboratory</p>Degré de pureté :Min. 95%Human Calcitonin ELISA kit
<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>Degré de pureté :Min. 95%Rabbit MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Degré de pureté :Min. 95%Human CXCL10 ELISA Kit
<p>ELISA kit for detection of CXCL10 in the research laboratory</p>Degré de pureté :Min. 95%ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%cAMP ELISA kit
<p>ELISA kit for the detection of cAMP in the research laboratory</p>Degré de pureté :Min. 95%IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Degré de pureté :Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Degré de pureté :Min. 95%Thymus peptide C
CAS :<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>Degré de pureté :Min. 95%Masse moléculaire :1,000 g/molHuman Leptin ELISA kit
<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>Degré de pureté :Min. 95%Mouse Cystatin C ELISA Kit
<p>ELISA kit for detection of Cystatin C in the research laboratory</p>Degré de pureté :Min. 95%Hamster (CHO) Glutathione S-Transferase P - ELISA Kit
<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>Degré de pureté :Min. 95%HCG ELISA kit
<p>ELISA Kit for detection of HCG in the research laboratory</p>Degré de pureté :Min. 95%Acetic acid-13C2, d3
CAS :Produit contrôlé<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C2H4O2Degré de pureté :Min. 95%Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
<p>Custom research peptide; min purity 95%.</p>Formule :C44H67N9O14Degré de pureté :Min. 95%Masse moléculaire :946.08 g/molMouse IgA ELISA Kit
<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human IFN β ELISA kit
<p>ELISA Kit for detection of IFNb in the research laboratory</p>Degré de pureté :Min. 95%Mouse MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Degré de pureté :Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>Human Myeloperoxidase (MPO) ELISA Kit
<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Gliadin screen ELISA kit
<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>Degré de pureté :Min. 95%Dysprosium(III) bromide
CAS :<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>Formule :Br3DyDegré de pureté :Min. 95%Masse moléculaire :402.21 g/molRat Thyroxine ELISA kit
<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%Cysteine
<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>Formule :C32H50O9N10S1Masse moléculaire :750.87 g/molPQR626
CAS :<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>Formule :C20H25F2N7O2Degré de pureté :Min. 95%Masse moléculaire :433.5 g/molPregnenolone ELISA kit
<p>ELISA kit for the detection of Pregnenolone in the research laboratory</p>Degré de pureté :Min. 95%Mouse Albumin ELISA Kit
<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>Degré de pureté :Min. 95%TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Degré de pureté :Min. 95%Human MMP1 ELISA Kit
<p>ELISA kit for detection of MMP1 in the research laboratory</p>Degré de pureté :Min. 95%Rat Transferrin ELISA Kit
<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Degré de pureté :Min. 95%Purified Borrelia burgdorferi OspA Protein
<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>Degré de pureté :Min. 95%Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Degré de pureté :Min. 95%Mouse Leptin ELISA Kit
<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>Degré de pureté :Min. 95%Coronavirus (SARS-CoV-2) Nucleoprotein - Purified
<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>Degré de pureté :Min. 95%Dog α 1-Acid Glycoprotein ELISA Kit
<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>Degré de pureté :Min. 95%PEDV Spike Protein - Purified
<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>Degré de pureté :Min. 95%Human CEA ELISA Kit
<p>ELISA Kit for detection of CEA in the research laboratory</p>Degré de pureté :Min. 95%Mouse Neurotrophin 3 ELISA Kit
<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>Degré de pureté :Min. 95%



