Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.085 produits)
- Par Biological Target(99.070 produits)
- Par usage/effets pharmacologiques(6.784 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.217 produits)
130575 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Lp-PLA2 antibody
<p>Lp-PLA2 antibody is a powerful tool in the field of Life Sciences. It specifically targets lipoprotein-associated phospholipase A2 (Lp-PLA2), an enzyme that plays a crucial role in the metabolism of fatty acids. By inhibiting Lp-PLA2, this antibody helps regulate chemokine levels, reducing inflammation and improving overall vascular health.</p>Selenoprotein antibody
<p>Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS</p>Degré de pureté :Min. 95%PPP1R8 antibody
<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK</p>OSTF1 protein (His tag)
<p>1-217 amino acids: MSKPPPKPVK PGEGGQVKVF RALYTFEPRT PDELYFEEGD IIYITDMSDT NWWKGTSKGR TGLIPSNYVA EQAESIDNPL HEAAKRGNLS WLRECLDNRV GVNGLDKAGS TALYWACHGG HKDIVEMLFT QPNIELNQQN KLGDTALHAA AWKGYADIVQ LFLAKGARTD LRNIEKKLAF DMATNAACAS LLKKKQGTDA VRTLSNAEDY LDDEDSDLEH HHHHH</p>Degré de pureté :Min. 95%SLC38A3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A3 antibody, catalog no. 70R-7037</p>Degré de pureté :Min. 95%KCNC1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNC1 antibody, catalog no. 70R-1810</p>Degré de pureté :Min. 95%Carboxypeptidase A1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPA1 antibody, catalog no. 70R-5489</p>Degré de pureté :Min. 95%TRAP1 antibody
<p>TRAP1 antibody was raised in rabbit using the N terminal of TRAP1 as the immunogen</p>Degré de pureté :Min. 95%MAPT Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPT antibody, catalog no. 70R-6021</p>Degré de pureté :Min. 95%IDS antibody
<p>The IDS antibody is a specific antibody widely used in Life Sciences research. It is commonly used for the detection and analysis of various proteins, including those involved in cellular signaling pathways, gene expression, and disease biomarkers. The IDS antibody has been extensively validated and is known for its high specificity and sensitivity.</p>ORAI1 antibody
<p>ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP</p>Degré de pureté :Min. 95%AKAP7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP7 antibody, catalog no. 70R-1065</p>Degré de pureté :Min. 95%WFDC2 antibody
<p>The WFDC2 antibody is a highly specialized monoclonal antibody that targets specific molecules involved in various biological processes. It has been extensively studied in the field of life sciences and has shown great potential in different applications.</p>JMJD1B antibody
<p>JMJD1B antibody was raised in rabbit using the C terminal of JMJD1B as the immunogen</p>Degré de pureté :Min. 95%TNF α antibody (biotin)
<p>TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.</p>Ssr2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ssr2 antibody, catalog no. 70R-8627</p>Degré de pureté :Min. 95%GC2 protein
<p>Region of GC2 protein corresponding to amino acids VLTELRCTCL RVTLRVNPKT IGKLQVFPAG PQCSKVEVVA SLKNGKQVCL DPEAPFLKKV IQKILDSGNK KN.</p>Degré de pureté :Min. 95%WDR8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR8 antibody, catalog no. 70R-2521</p>Degré de pureté :Min. 95%MKRN2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AMZ2 antibody, catalog no. 70R-9376</p>Degré de pureté :Min. 95%C14ORF148 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf148 antibody, catalog no. 70R-3453</p>Degré de pureté :Min. 95%Goat anti Rat IgG (H + L) (biotin)
<p>Goat anti-rat IgG (H+L) (biotin) was raised in goat using rat IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%FANCA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FANCA antibody, catalog no. 70R-3337</p>Degré de pureté :Min. 95%DSCR1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this medication inhibits bacterial growth, preventing transcription and replication. Its bactericidal activity has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>RSBN1 antibody
<p>RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG</p>ASB6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASB6 antibody, catalog no. 70R-5879</p>Degré de pureté :Min. 95%ZNF442 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF442 antibody, catalog no. 70R-9593</p>Degré de pureté :Min. 95%Hemoglobin protein (Mouse)
<p>Purified native Hemoglobin protein (Mouse)</p>Degré de pureté :>95% By Sds-PageAURKC Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AURKC antibody, catalog no. 70R-2679</p>Degré de pureté :Min. 95%CA5A antibody
<p>CA5A antibody was raised in rabbit using the C terminal of CA5A as the immunogen</p>Degré de pureté :Min. 95%GPR27 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR27 antibody, catalog no. 70R-7335</p>Degré de pureté :Min. 95%PSCA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSCA antibody, catalog no. 70R-8532</p>Degré de pureté :Min. 95%CDK8 antibody
<p>The CDK8 antibody is a polyclonal antibody that targets CDK8, a protein involved in various cellular processes. It has been shown to interact with β-catenin and mitogen-activated protein kinases, regulating their activity. This antibody can be used in life sciences research to study the role of CDK8 in cell signaling pathways and transcriptional regulation. Additionally, it has been used for immunohistochemistry and Western blotting to detect CDK8 expression in different tissues and cell lines. The CDK8 antibody is highly specific and does not cross-react with other proteins, ensuring accurate results. It is a valuable tool for researchers studying the function of CDK8 and its involvement in disease processes.</p>FNTA antibody
<p>FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV</p>BMP7 antibody
<p>BMP7 antibody was raised in mouse using recombinant human BMP7 (293-431aa) purified from E. coli as the immunogen.</p>CD70 antibody
<p>The CD70 antibody is a highly specialized product in the field of Life Sciences. It acts as a growth factor and plays a crucial role in microvessel density regulation. This antibody specifically targets alpha-synuclein, an antigen associated with neurodegenerative disorders.</p>SUSD4 antibody
<p>SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV</p>Degré de pureté :Min. 95%
